Escherichia coli UM146: UM146_01475 Help Entry UM146_01475       CDS       T02000                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism elu  Escherichia coli UM146 Pathway elu01100   Metabolic pathways elu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:elu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     UM146_01475    00074 Mycolic acid biosynthesis     UM146_01475   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     UM146_01475 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 BH4 Motif Other DBs NCBI-ProteinID:  ADN69724 LinkDB All DBs Position complement(305343..305591) Genome browser AA seq 82 aa AA seqDB search MVNREIVMDYILSCLQDLVENGVEIKPDSDLVNDLGLESIKVMDLLMMLEDRFDISIPIN ILLDVKTPAQLMETLLPWLENN NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggtaaatcgtgaaatagtaatggattacatcctttcctgtttacaggatttggtcgaa aacggtgtggaaattaagcccgacagcgatctcgtcaacgatcttggcctggagtcgatc aaagtgatggatctcttaatgatgctggaagacagattcgatatttccattcctattaat attctgctggatgtcaaaacccctgcgcaattaatggaaactctacttccatggctggag aataactaa

DBGET integrated database retrieval system