KEGG   Escherichia coli UM146: UM146_08865
Entry
UM146_08865       CDS       T02000                                 
Name
(GenBank) predicted transporter
  KO
K19577  MFS transporter, DHA1 family, inner membrane transport protein
Organism
elu  Escherichia coli UM146
Brite
KEGG Orthology (KO) [BR:elu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:elu02000]
    UM146_08865
Transporters [BR:elu02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    UM146_08865
SSDB
Motif
Pfam: MFS_1 MFS_4 Sugar_tr
Other DBs
NCBI-ProteinID: ADN71160
LinkDB
Position
1870230..1871399
AA seq 389 aa
MKINYPLLALAIGAFGIGTTEFSPMGLLPVIARGVDVSIPAAGMLISAYAVGVMVGAPLM
TLLLSHRARRSALIFLMAIFTLGNVLSAIAPDYMTLMLSRILTSLNHGAFFGLGSVVAAS
VVPKHKQASAVATMFMGLTLANIGGVPAATWLGETIGWRMSFLATAGLGVISMVSLFFSL
PKGGAGARPEVKKELAVLMRPQVLSALLTTVLGAGAMFTLYTYISPVLQSITHVTPVFVT
AMLVLIGVGFSIGNYLGGKLADRSVNGTLKGFLLLLMVIMLVIPFLARNEFGAAISMVVW
GAATFAVVPPLQMRVMRVASEAPGLSSSVNIGAFNLGNALGAAAGGAVISAGLGYSFVPV
MGAIVAGLALLLVFMSVRKQPETVCVANS
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgaaaattaactatccgttgctggcgctggcgattggcgcgtttggtatcgggacaacg
gagttctcgccaatgggcttgttgcccgtcattgcgcgcggtgtggatgtctcgattccc
gctgccggaatgttaatcagtgcttatgcagttggcgtaatggttggcgcgccgctgatg
acgcttctactttctcatcgtgcccgccgcagtgcgttgattttcctgatggcgattttc
acgcttggcaacgtactttccgccatcgcgccggattatatgaccctgatgctttcacgc
attttgaccagcctgaatcacggggcattttttggtttgggttcagtcgtggccgcaagc
gtagtgccaaaacataaacaggctagcgcagttgccactatgtttatggggttaaccctg
gcaaatatcggtggcgtgccggcggcgacctggttgggcgaaaccatcggctggcggatg
tcatttctggcaacagcggggctgggcgtgatttcaatggtaagtctgttcttctcatta
cctaaaggtggcgcaggggcgcgacctgaagtgaaaaaagagctggcggtattaatgcgt
ccgcaggtgctgtctgcattgctgacgacggtactgggcgctggtgcaatgtttaccctc
tacacctatatctctccggtactgcaaagtattacccacgtaacgccggtgttcgtcacg
gcaatgctggtgctgattggtgtcggattttctatcggtaactatctcggcggcaaactg
gcagatcgttcagttaacggcacgttgaaaggctttttgttgttgctgatggtgattatg
ctggtaatcccgttcctggcccgcaatgagttcggcgcagctattagcatggtagtgtgg
ggagctgcaacctttgcggtcgtaccgccgttacagatgcgcgtgatgcgtgtcgccagt
gaagcgccaggtctgtcttcatcagtcaatattggtgcctttaatcttggaaatgcgctg
ggagcagctgctggtggtgcggtaatttccgctgggctgggatacagttttgtgccggtg
atgggggcgattgtcgcgggactggcattattgctggtgtttatgtcagtcagaaaacaa
cctgaaacagtttgcgttgccaacagctaa

DBGET integrated database retrieval system