Escherichia coli UM146: UM146_08865
Help
Entry
UM146_08865 CDS
T02000
Name
(GenBank) predicted transporter
KO
K19577
MFS transporter, DHA1 family, inner membrane transport protein
Organism
elu
Escherichia coli UM146
Brite
KEGG Orthology (KO) [BR:
elu00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
elu02000
]
UM146_08865
Transporters [BR:
elu02000
]
Major facilitator superfamily (MFS)
Drug transporters
Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:
2.A.1.2
]
UM146_08865
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
MFS_1
MFS_4
Sugar_tr
Motif
Other DBs
NCBI-ProteinID:
ADN71160
LinkDB
All DBs
Position
1870230..1871399
Genome browser
AA seq
389 aa
AA seq
DB search
MKINYPLLALAIGAFGIGTTEFSPMGLLPVIARGVDVSIPAAGMLISAYAVGVMVGAPLM
TLLLSHRARRSALIFLMAIFTLGNVLSAIAPDYMTLMLSRILTSLNHGAFFGLGSVVAAS
VVPKHKQASAVATMFMGLTLANIGGVPAATWLGETIGWRMSFLATAGLGVISMVSLFFSL
PKGGAGARPEVKKELAVLMRPQVLSALLTTVLGAGAMFTLYTYISPVLQSITHVTPVFVT
AMLVLIGVGFSIGNYLGGKLADRSVNGTLKGFLLLLMVIMLVIPFLARNEFGAAISMVVW
GAATFAVVPPLQMRVMRVASEAPGLSSSVNIGAFNLGNALGAAAGGAVISAGLGYSFVPV
MGAIVAGLALLLVFMSVRKQPETVCVANS
NT seq
1170 nt
NT seq
+upstream
nt +downstream
nt
atgaaaattaactatccgttgctggcgctggcgattggcgcgtttggtatcgggacaacg
gagttctcgccaatgggcttgttgcccgtcattgcgcgcggtgtggatgtctcgattccc
gctgccggaatgttaatcagtgcttatgcagttggcgtaatggttggcgcgccgctgatg
acgcttctactttctcatcgtgcccgccgcagtgcgttgattttcctgatggcgattttc
acgcttggcaacgtactttccgccatcgcgccggattatatgaccctgatgctttcacgc
attttgaccagcctgaatcacggggcattttttggtttgggttcagtcgtggccgcaagc
gtagtgccaaaacataaacaggctagcgcagttgccactatgtttatggggttaaccctg
gcaaatatcggtggcgtgccggcggcgacctggttgggcgaaaccatcggctggcggatg
tcatttctggcaacagcggggctgggcgtgatttcaatggtaagtctgttcttctcatta
cctaaaggtggcgcaggggcgcgacctgaagtgaaaaaagagctggcggtattaatgcgt
ccgcaggtgctgtctgcattgctgacgacggtactgggcgctggtgcaatgtttaccctc
tacacctatatctctccggtactgcaaagtattacccacgtaacgccggtgttcgtcacg
gcaatgctggtgctgattggtgtcggattttctatcggtaactatctcggcggcaaactg
gcagatcgttcagttaacggcacgttgaaaggctttttgttgttgctgatggtgattatg
ctggtaatcccgttcctggcccgcaatgagttcggcgcagctattagcatggtagtgtgg
ggagctgcaacctttgcggtcgtaccgccgttacagatgcgcgtgatgcgtgtcgccagt
gaagcgccaggtctgtcttcatcagtcaatattggtgcctttaatcttggaaatgcgctg
ggagcagctgctggtggtgcggtaatttccgctgggctgggatacagttttgtgccggtg
atgggggcgattgtcgcgggactggcattattgctggtgtttatgtcagtcagaaaacaa
cctgaaacagtttgcgttgccaacagctaa
DBGET
integrated database retrieval system