Escherichia coli UM146: UM146_11970 Help Entry UM146_11970       CDS       T02000                                  Name (GenBank) anti-sigma28 factor FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism elu  Escherichia coli UM146 Pathway elu02020   Two-component system elu02026   Biofilm formation - Escherichia coli elu02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:elu00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     UM146_11970  09140 Cellular Processes   09145 Cellular community - prokaryotes    02026 Biofilm formation - Escherichia coli     UM146_11970   09142 Cell motility    02040 Flagellar assembly     UM146_11970  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:elu02035]     UM146_11970 Bacterial motility proteins [BR:elu02035]  Flagellar system   Flagellar assembly proteins    Others     UM146_11970 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  ADN71763 LinkDB All DBs Position 2467251..2467544 Genome browser AA seq 97 aa AA seqDB search MSIDRTSPLKPVSTVQPRETTDAPVTNTRAAKTTASTSTSVTLSDAQAKLMQPGSSDINL ERVEALKLAIRNGELKMDTGKIADALINEAQQDLQSN NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgagtattgatcgcacttcgcctctgaagccagtaagcaccgttcaaccgcgcgaaacc actgacgcgccggtaacaaacacccgagcggcaaaaacaacagcctccaccagcaccagt gtgacgttaagcgacgcgcaagcaaaactgatgcaacccggcagcagcgatatcaatctt gaacgtgtcgaagcgttaaaactggcgattcgtaacggtgaactaaaaatggacaccggc aaaattgccgatgcgctgatcaacgaagcgcagcaagacttgcagagtaattga

DBGET integrated database retrieval system