Escherichia coli UM146: UM146_13955 Help Entry UM146_13955       CDS       T02000                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism elu  Escherichia coli UM146 Pathway elu00190   Oxidative phosphorylation elu01100   Metabolic pathways elu02020   Two-component system Module elu_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:elu00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     UM146_13955  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     UM146_13955 Enzymes [BR:elu01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      UM146_13955 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  ADN72156 LinkDB All DBs Position complement(2877019..2877132) Genome browser AA seq 37 aa AA seqDB search MWYFAWILGTLLACSFGVITALALEHVESGKAGQEDI NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcatggattctgggaacgcttcttgcctgttcgtttggggtaatcacc gcgctggcgcttgagcacgtcgaatcaggcaaagccggtcaagaagacatctga

DBGET integrated database retrieval system