Ereboglobus luteus: CKA38_06280 Help Entry CKA38_06280       CDS       T09773                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism elut  Ereboglobus luteus Pathway elut00998   Biosynthesis of various antibiotics elut01100   Metabolic pathways elut01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:elut00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CKA38_06280    00074 Mycolic acid biosynthesis     CKA38_06280   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CKA38_06280 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AWI08911 UniProt:  A0A2U8E247 LinkDB All DBs Position 1686663..1686938 Genome browser AA seq 91 aa AA seqDB search MSDSLIPRLKQIIITTLNLEGMTPEEIDENAPLIGSGLALDSIDALELVVKLEKEFGIKI SSSEESRAALASITSLAEFIRNRADPSKLSA NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgtccgattcgctcataccacgtttgaaacagatcatcatcacaacgctcaatctcgag ggaatgactcccgaggagattgacgagaacgcgccgctcatcggctccgggctggcgctc gactcgatcgacgcgctcgagctcgttgtgaaactcgaaaaggaattcggcatcaaaatc tccagcagcgaggaatcgcgcgccgcccttgcgagcatcacgagccttgccgagttcatt cgcaatcgcgccgacccctccaagctctccgcctga

DBGET integrated database retrieval system