Ereboglobus luteus: CKA38_14420
Help
Entry
CKA38_14420 CDS
T09773
Name
(GenBank) hypothetical protein
KO
K07091
lipopolysaccharide export system permease protein
Organism
elut
Ereboglobus luteus
Pathway
elut02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
elut00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
CKA38_14420
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
elut02000
]
CKA38_14420
Transporters [BR:
elut02000
]
ABC transporters, prokaryotic type
ABC-2 type and other transporters
Lipopolysaccharide transporter
CKA38_14420
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
LptF_LptG
Motif
Other DBs
NCBI-ProteinID:
AWI10286
UniProt:
A0A2U8E630
LinkDB
All DBs
Position
complement(3973759..3974892)
Genome browser
AA seq
377 aa
AA seq
DB search
MFKILHRYIASSVLSSAAAAIVFIGFIFGAVNLLKDVLVYLLDGRIPFGLFLKLCWDMAQ
YVGTYAVPIGMLIGVLLVLGRMSADNEITAMRTSGRSILQIARPILVIALFGVVAELGIN
FYLMPKSRVSYHVELEKALRHSAANFFVPRTFMREIPGAVIFFDKKDGQTYQNLWVWLLD
NQQRATYIYHAASAVIEFDLDREILRVLPFEGNIEARAVADPEKRADHNNILQMGGTEQA
VEIPLGDFLGRRGFRQKLNWLTLPELLERRTELAHDPKATDIDRLKVTLTIHNKLTFSLG
VFSFALIAIPLGIRTQRKESSANIGIAMLLVVVYYVMSVAVGWLDKRPDLHPEILIWLPN
AVFIGTGLILLRRVERT
NT seq
1134 nt
NT seq
+upstream
nt +downstream
nt
atgttcaaaatcctacatcgttatatcgccagctccgtcctttcctcggcggcggcggcg
attgttttcataggatttatttttggcgcggtcaatttgctcaaggatgtgctcgtgtat
ctgctcgacgggcgcattcccttcgggctcttcctgaaattgtgctgggacatggcccaa
tacgtgggcacctacgccgtgcccatcggcatgctcatcggcgtgctgctcgtgctcggg
cgcatgtcggcggacaacgagatcaccgccatgcgcacttcggggcgtagcattttgcaa
atcgcgcgcccgattcttgtgattgcgttgttcggcgtcgtcgctgagctcggcatcaat
ttttatctcatgccaaagtcgcgcgtgtcctaccacgtcgagcttgagaaggcgctccgg
cattcggcggcgaacttttttgtgccgcgcactttcatgcgcgagattccgggagcggtc
atttttttcgacaagaaggacggccagacttaccagaacctctgggtgtggctgttggac
aaccagcagcgcgcgacctacatttatcacgcggcgtccgccgtcattgagttcgatttg
gacagggaaatcctgcgcgtgctgcctttcgagggcaacatcgaggcgcgcgcggtggcc
gatccggagaagcgcgccgaccacaacaacatcctgcaaatgggcggcacggagcaggcg
gttgagattccgctcggcgattttctcggcaggcgcggtttcaggcaaaagctcaactgg
ctcacgctgccggaacttctggagcggaggaccgagctcgcgcacgacccgaaggccacc
gacatcgaccggctgaaggtcacgctcacgattcacaacaagctcacgttttcgctcggg
gtgttttcgttcgcgctcattgcgattccgctcggcatccgcacgcagcgcaaggagtcg
tcggcaaacatcggcatcgcgatgctgctcgttgtggtgtattacgtgatgtcggtcgcg
gtcggctggctcgacaagcggcccgacttgcatccggagattttgatctggctgccgaac
gcggttttcatcggcacgggattgatacttttacggcgcgtggagcggacgtga
DBGET
integrated database retrieval system