KEGG   Ereboglobus luteus: CKA38_14420
Entry
CKA38_14420       CDS       T09773                                 
Name
(GenBank) hypothetical protein
  KO
K07091  lipopolysaccharide export system permease protein
Organism
elut  Ereboglobus luteus
Pathway
elut02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:elut00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CKA38_14420
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:elut02000]
    CKA38_14420
Transporters [BR:elut02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter
    CKA38_14420
SSDB
Motif
Pfam: LptF_LptG
Other DBs
NCBI-ProteinID: AWI10286
UniProt: A0A2U8E630
LinkDB
Position
complement(3973759..3974892)
AA seq 377 aa
MFKILHRYIASSVLSSAAAAIVFIGFIFGAVNLLKDVLVYLLDGRIPFGLFLKLCWDMAQ
YVGTYAVPIGMLIGVLLVLGRMSADNEITAMRTSGRSILQIARPILVIALFGVVAELGIN
FYLMPKSRVSYHVELEKALRHSAANFFVPRTFMREIPGAVIFFDKKDGQTYQNLWVWLLD
NQQRATYIYHAASAVIEFDLDREILRVLPFEGNIEARAVADPEKRADHNNILQMGGTEQA
VEIPLGDFLGRRGFRQKLNWLTLPELLERRTELAHDPKATDIDRLKVTLTIHNKLTFSLG
VFSFALIAIPLGIRTQRKESSANIGIAMLLVVVYYVMSVAVGWLDKRPDLHPEILIWLPN
AVFIGTGLILLRRVERT
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgttcaaaatcctacatcgttatatcgccagctccgtcctttcctcggcggcggcggcg
attgttttcataggatttatttttggcgcggtcaatttgctcaaggatgtgctcgtgtat
ctgctcgacgggcgcattcccttcgggctcttcctgaaattgtgctgggacatggcccaa
tacgtgggcacctacgccgtgcccatcggcatgctcatcggcgtgctgctcgtgctcggg
cgcatgtcggcggacaacgagatcaccgccatgcgcacttcggggcgtagcattttgcaa
atcgcgcgcccgattcttgtgattgcgttgttcggcgtcgtcgctgagctcggcatcaat
ttttatctcatgccaaagtcgcgcgtgtcctaccacgtcgagcttgagaaggcgctccgg
cattcggcggcgaacttttttgtgccgcgcactttcatgcgcgagattccgggagcggtc
atttttttcgacaagaaggacggccagacttaccagaacctctgggtgtggctgttggac
aaccagcagcgcgcgacctacatttatcacgcggcgtccgccgtcattgagttcgatttg
gacagggaaatcctgcgcgtgctgcctttcgagggcaacatcgaggcgcgcgcggtggcc
gatccggagaagcgcgccgaccacaacaacatcctgcaaatgggcggcacggagcaggcg
gttgagattccgctcggcgattttctcggcaggcgcggtttcaggcaaaagctcaactgg
ctcacgctgccggaacttctggagcggaggaccgagctcgcgcacgacccgaaggccacc
gacatcgaccggctgaaggtcacgctcacgattcacaacaagctcacgttttcgctcggg
gtgttttcgttcgcgctcattgcgattccgctcggcatccgcacgcagcgcaaggagtcg
tcggcaaacatcggcatcgcgatgctgctcgttgtggtgtattacgtgatgtcggtcgcg
gtcggctggctcgacaagcggcccgacttgcatccggagattttgatctggctgccgaac
gcggttttcatcggcacgggattgatacttttacggcgcgtggagcggacgtga

DBGET integrated database retrieval system