Candidatus Enterovibrio altilux: BTN50_0955 Help Entry BTN50_0955        CDS       T09803                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism elux  Candidatus Enterovibrio altilux Pathway elux02024   Quorum sensing elux03018   RNA degradation Brite KEGG Orthology (KO) [BR:elux00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     BTN50_0955  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     BTN50_0955  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:elux03019]     BTN50_0955    03036 Chromosome and associated proteins [BR:elux03036]     BTN50_0955 Messenger RNA biogenesis [BR:elux03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      BTN50_0955 Chromosome and associated proteins [BR:elux03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     BTN50_0955 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  ATF09460 UniProt:  A0A291B8Y2 LinkDB All DBs Position 1:967204..967473 Genome browser AA seq 89 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNVVNQMIYKHAIS TVVPARSVNHYDTTNERYQNDRTQNKIEE NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatcgctacaagatccatttctgaatgcactacggcgtgaacgcgta cctgtctcaatatatcttgttaacggtatcaaacttcaaggccagattgagtcatttgac caattcgtgatactgctcaaaaatgtcgtgaatcaaatgatttataaacacgctatatct acagtcgtaccagctcgctcggtaaatcattacgatacgactaacgaacgttatcagaac gaccgtacacaaaataaaattgaggaataa

DBGET integrated database retrieval system