Candidatus Enterovibrio altilux: BTN50_2078 Help Entry BTN50_2078        CDS       T09803                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism elux  Candidatus Enterovibrio altilux Pathway elux01100   Metabolic pathways elux01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:elux00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BTN50_2078    00074 Mycolic acid biosynthesis     BTN50_2078   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BTN50_2078 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB EutQ Motif Other DBs NCBI-ProteinID:  ATF10486 UniProt:  A0A291BBW7 LinkDB All DBs Position 2:complement(293484..293720) Genome browser AA seq 78 aa AA seqDB search MSNIEKRVKKIIIEQLGVNEAEVKNEASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYVVGASE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaacattgaaaaacgagtaaaaaaaataatcatcgagcaactaggtgtaaacgaa gctgaagttaagaatgaagcatcttttgttgatgaccttggcgctgactcactagacaca gttgagttagtcatggctttggaagaagagttcgacaccgagattccagacgaagaagca gagaagattactaccgttcaagccgctattgactatgttgttggtgcgtctgagtaa

DBGET integrated database retrieval system