Escherichia coli W: ECW_m2908
Help
Entry
ECW_m2908 CDS
T02002
Symbol
norR
Name
(GenBank) DNA-binding transcriptional activator
KO
K12266
anaerobic nitric oxide reductase transcription regulator
Organism
elw
Escherichia coli W
Brite
KEGG Orthology (KO) [BR:
elw00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03000 Transcription factors [BR:
elw03000
]
ECW_m2908 (norR)
Transcription factors [BR:
elw03000
]
Prokaryotic type
Helix-turn-helix
Other families
ECW_m2908 (norR)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Sigma54_activat
Sigma54_activ_2
GAF
GAF_2
Mg_chelatase
MCM
AAA_5
AAA
GAF_3
AAA_2
AAA_19
AAA_16
AAA_22
AAA_30
HTH_8
DBD_HTH
AAA_7
Motif
Other DBs
NCBI-ProteinID:
ADT76312
UniProt:
E0J5P9
LinkDB
All DBs
Position
complement(2979230..2980744)
Genome browser
AA seq
504 aa
AA seq
DB search
MSFSVDVLANIAIELQRGIGHQDRFQRLITTLRQVLECDASALLRYDSRQFIPLAIDGLA
KDVLGRRFALEGHPRLEAIARAGDVVRFPADSELPDPYDGLIPGQESLKVHACVGLPLFA
GQNLIGALTLDGMQPDQFDVFSDEELRLIAALAAGALSNALLIEQLESQNMLPGDAAPFE
AVKQTQMIGLSPGMTQLKKEIEIVAASDLNVLISGETGTGKELVAKAIHEASPRAVNPLI
YLNCAALPESVAESELFGHVKGAFTGAISNRSGKFEMADNGTLFLDEIGELSLALQAKLL
RVLQYGDIQRVGDDRSLRVDVRVLAATNRDLREEVLAGRFRADLFHRLSVFPLSVPPLRE
RGDDVILLAGYFCEQCRLRLGLSRVVLSAGARNLLQHYRFPGNVRELEHAIHRAVVLARA
TRNGDEVILEAQHFAFPEVTLPPPEAAAVPVVKQNLREATEAFQRETIRQALAQNHHNWA
ACARMLETDVANLHRLAKRLGLKD
NT seq
1515 nt
NT seq
+upstream
nt +downstream
nt
atgagtttttccgttgatgtgctggcgaatatcgccatcgaattgcagcgtgggattggt
catcaggatcgttttcagcgcctgatcaccacgctacgtcaggtgctggagtgcgatgcg
tctgcgttgctacgttacgattcgcggcagtttattccgcttgccatcgacggtctggca
aaggatgtactcggtagacgctttgcgctggaagggcatccacggcttgaagcgattgcc
cgcgccggggacgtggtgcgctttcctgcagacagcgaattgcccgatccctatgacggt
ttgattcctgggcaggagagtctgaaggttcacgcctgcgttggtctgccattgtttgcc
gggcaaaacctgattggcgcattgacgctcgacgggatgcagcccgatcagttcgatgtt
ttcagcgatgaagagttacggctgattgctgcgctggcggcgggagcgttaagcaatgcg
ttgctgattgagcaactggaaagccagaatatgctgccgggcgatgccgcgccgtttgaa
gcggtgaaacagacgcagatgattggcttatcgccaggcatgacgcaattgaaaaaagag
attgagattgtggcggcgtccgatctcaacgtcttaatcagcggtgagacgggaaccggt
aaggagctggtggcgaaagcgattcatgaagcctcgccacgggcggtgaatccgctgatc
tatctcaactgtgccgcactgccggaaagtgtggcggaaagtgaactgttcgggcatgtg
aaaggggcgtttactggcgctatcagtaaccgcagcgggaagtttgaaatggcggataac
ggcacactgtttctggatgagatcggcgagttgtcgttggcattgcaggccaagctgctg
agggtgttgcagtatggcgatattcagcgcgttggcgatgaccgcagtttgcgggtcgat
gtgcgcgtgctggcggcgactaaccgcgacttacgcgaagaggtgctggcagggcgattt
cgcgctgacttgtttcatcgcctgagcgtgtttccactttcggtgccgccgctgcgtgag
cggggcgatgatgtcattctgctggcggggtatttctgcgagcagtgtcgtttgcggctg
gggctctcccgcgtggtattaagtgccggagcgcgaaatttactgcaacactatcgtttt
ccggggaacgtgcgcgaactggaacatgctattcatcgggcggtagtgctggcgagagcc
acccgcaacggcgatgaagtgattcttgaggcgcaacattttgcttttcctgaggtgacg
ttgccgccgccagaagcggcggcggtgcccgttgttaagcaaaacctgcgtgaagcgaca
gaagcgttccagcgtgaaaccattcgccaggcactggcacaaaatcatcacaactgggct
gcctgcgcgcggatgctggaaaccgacgtcgccaacctgcatcggctggcgaaacgtctg
ggattgaaggattaa
DBGET
integrated database retrieval system