Escherichia coli W: ECW_m3251 Help Entry ECW_m3251         CDS       T02002                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism elw  Escherichia coli W Pathway elw01100   Metabolic pathways elw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:elw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ECW_m3251   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ECW_m3251 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding BH4 Motif Other DBs NCBI-ProteinID:  ADT76623 UniProt:  E0IW20 LinkDB All DBs Position 3342325..3342573 Genome browser AA seq 82 aa AA seqDB search MVNREIVMDYILSCLQDLVENGVEIKPDSDLVNDLGLESIKVMDLLMMLEDRFDISIPIN ILLDVKTPAQLMETLLPWLENK NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggtaaatcgtgaaatagtaatggattacatcctttcctgtttacaggatttggtcgaa aacggtgtggaaattaagcccgacagcgatctcgtcaacgatcttggcctggagtcgatc aaagtgatggatctcttaatgatgctggaagacagattcgatatttccattcctattaat attctgctggatgtcaaaacccctgcgcaattaatggaaactctacttccatggctggag aataaataa

DBGET integrated database retrieval system