KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_4773
Entry
CDCO157_4773      CDS       T02122                                 
Name
(GenBank) phosphonate/organophosphate ester transporter subunit
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Pathway
elx02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:elx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CDCO157_4773
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:elx02000]
    CDCO157_4773
Enzymes [BR:elx01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     CDCO157_4773
Transporters [BR:elx02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    CDCO157_4773
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_29 RsgA_GTPase AAA_16 SMC_N AAA_23 NACHT nSTAND1 AAA_25 AAA_5 Mg_chelatase AAA_18 AAA_22 AAA_30 PRK MMR_HSR1 ORC-CDC6-like AAA_28 nSTAND3 T2SSE AAA_33 SbcC_Walker_B Rad17 PhoH AAA_24 bpMoxR AAA_7 AAA_19 cobW AAA_14 TsaE
Other DBs
NCBI-ProteinID: AFJ31823
LinkDB
Position
complement(5067203..5067991)
AA seq 262 aa
MQTIICVEQLSKTFNQHQALHAVDLNIHHGEMVALLGPSGSGKSTLLRHLSGLITGDKSA
GSHIELLGRTVQREGRLARDIRKSRANTGYIFQQFNLVNRLSVLENVLIGALGSTPFWRT
CFSWFTREQKQRALQALTRVGMAHFAYQRVSTLSGGQQQRVAIARALMQQAKVILADEPI
ASLDPESARIVMDTLRDINQNDGITVVVTLHQVDYALRYCERIVALRQGHVFYDGSSQQF
DNERFDHLYRSINRVEENAKAA
NT seq 789 nt   +upstreamnt  +downstreamnt
atgcaaacgattatctgcgtcgaacaactgagcaaaaccttcaaccagcatcaggcgctg
cacgcggttgatctgaatatccatcatggtgaaatggtggctctgcttgggccgtccggt
tccggcaaatccacccttttacgtcacttaagcggtttgattaccggcgataaatccgcc
ggtagccatatcgagctgctgggccgcactgtccagcgcgaaggccgcctggcccgcgat
atccgcaaaagccgcgccaacaccggctacatcttccaacaattcaacctggtgaatcgc
ctgagcgtactggagaacgtgctgattggcgcgctcggcagcacgccgttctggcgcacc
tgttttagttggttcacccgcgagcagaaacagcgcgcattacaggcgctgacccgcgtc
ggtatggcgcactttgcgtatcagcgtgtttccacgctctccggcggccagcagcagcgt
gtggcgattgcccgcgcgctgatgcagcaggcgaaagtgattctcgctgacgaaccgatc
gcctcgctggacccggaatcggcgcgcatcgtgatggacaccctgcgcgacatcaaccag
aacgacggcatcaccgtggtcgtcacgctgcatcaggtggattacgccctgcgctactgc
gaacgcatcgtcgccctgcgccaggggcacgtcttctacgacggcagcagccaacagttt
gataacgaacgttttgaccatctctaccgcagcatcaaccgcgtcgaagagaacgcgaaa
gctgcctga

DBGET integrated database retrieval system