Epinephelus lanceolatus (giant grouper): 117246314 Help Entry 117246314         CDS       T07331                                  Symbol cxcl19 Name (RefSeq) C-X-C motif chemokine 19   KO K10030   interleukin 8 Organism ely  Epinephelus lanceolatus (giant grouper) Pathway ely04060   Cytokine-cytokine receptor interaction ely04218   Cellular senescence ely04620   Toll-like receptor signaling pathway ely04621   NOD-like receptor signaling pathway ely04622   RIG-I-like receptor signaling pathway ely05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ely00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     117246314 (cxcl19)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     117246314 (cxcl19)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     117246314 (cxcl19)    04621 NOD-like receptor signaling pathway     117246314 (cxcl19)    04622 RIG-I-like receptor signaling pathway     117246314 (cxcl19)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     117246314 (cxcl19)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ely04052]     117246314 (cxcl19)    00536 Glycosaminoglycan binding proteins [BR:ely00536]     117246314 (cxcl19) Cytokines and neuropeptides [BR:ely04052]  Cytokines   Chemokines    117246314 (cxcl19) Glycosaminoglycan binding proteins [BR:ely00536]  Heparan sulfate / Heparin   Chemokines    117246314 (cxcl19) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  117246314 NCBI-ProteinID:  XP_033466064 LinkDB All DBs Position 20:complement(26496619..26502932) Genome browser AA seq 103 aa AA seqDB search MKLCILLMLGTLLVLVYGMPPISRDYNTHCRCLQVESRIIPPNSLKSIKLVPEGPHCPDM EVIAGLSNGEKVCLNPRSSWVKKLVNFVLEKQQGGALPKNQGQ NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgaagctctgcatcctgctcatgctcgggaccctgcttgtcctcgtttatggaatgccg ccaatcagcagggactacaacacacactgtcgctgccttcaggtggagtcgaggattatc cctccaaacagcctgaagagcatcaagctcgtccctgaagggccccactgcccagatatg gaagtcatagctggactgtcgaacggggagaaggtgtgcctgaaccctcggtcctcctgg gtgaagaagcttgtcaactttgttctggagaagcagcagggaggagcacttcccaagaat caggggcaataa

DBGET integrated database retrieval system