Epinephelus lanceolatus (giant grouper): 117247584 Help Entry 117247584         CDS       T07331                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism ely  Epinephelus lanceolatus (giant grouper) Pathway ely04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ely00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     117247584  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ely04121]     117247584    03400 DNA repair and recombination proteins [BR:ely03400]     117247584 Ubiquitin system [BR:ely04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      117247584    Cul5 complex      117247584 DNA repair and recombination proteins [BR:ely03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      117247584 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  117247584 NCBI-ProteinID:  XP_033468058 LinkDB All DBs Position 21:complement(19998584..20003440) Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRPPEDQRLYKDDQLLEDSKTLGDS GFTNQTARPQAPATVGLAFRINDEMFEQLHIEAFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcttaatgatccggcgtcacaagaccacaatcttcacagatgccaaggag tctaccactgtgtatgagctgaagcgtattgttgaagggattcttaagagaccacccgaa gaccagaggctgtacaaagatgaccagttgctagaggacagcaaaactcttggtgactct ggattcaccaaccagactgccagacctcaagctccagctacagttggtctggcgttccgc ataaatgatgagatgtttgaacagctgcacatcgaggccttctccagccccccagaactc cctgatgtgatgaagcctcaggactccggtagcactgccaacgagcaggcggtgcagtga

DBGET integrated database retrieval system