Epinephelus lanceolatus (giant grouper): 117251861 Help Entry 117251861         CDS       T07331                                  Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism ely  Epinephelus lanceolatus (giant grouper) Pathway ely04020   Calcium signaling pathway ely04070   Phosphatidylinositol signaling system ely04114   Oocyte meiosis ely04218   Cellular senescence ely04261   Adrenergic signaling in cardiomyocytes ely04270   Vascular smooth muscle contraction ely04371   Apelin signaling pathway ely04625   C-type lectin receptor signaling pathway ely04744   Phototransduction ely04910   Insulin signaling pathway ely04912   GnRH signaling pathway ely04916   Melanogenesis Brite KEGG Orthology (KO) [BR:ely00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     117251861    04020 Calcium signaling pathway     117251861    04070 Phosphatidylinositol signaling system     117251861  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     117251861    04218 Cellular senescence     117251861  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     117251861   09152 Endocrine system    04910 Insulin signaling pathway     117251861    04912 GnRH signaling pathway     117251861    04916 Melanogenesis     117251861   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     117251861    04270 Vascular smooth muscle contraction     117251861   09157 Sensory system    04744 Phototransduction     117251861  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ely01009]     117251861   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ely04131]     117251861    03036 Chromosome and associated proteins [BR:ely03036]     117251861   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ely04147]     117251861 Protein phosphatases and associated proteins [BR:ely01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      117251861 Membrane trafficking [BR:ely04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     117251861 Chromosome and associated proteins [BR:ely03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      117251861 Exosome [BR:ely04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    117251861 SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 CFAP251_C AIF-1 EF-hand_9 EH SAPC2_N EF-hand_11 p25-alpha MTIP_N EF-hand_EFHB_C DUF5580_M EFhand_Ca_insen SurA_N_3 FlgD GPHH Motif Other DBs NCBI-GeneID:  117251861 NCBI-ProteinID:  XP_033474303 LinkDB All DBs Position 2:12831666..12839109 Genome browser AA seq 153 aa AA seqDB search MAKFFTPVQINEYKECFSLYDKKQKGKIAANDLITVMRCLGTSPTFGEIERHLQVHKIEK TGELDFSTFLTMMHRQMQQEDPKAEILEALRMTDKQKKGYIQASELRAKLTKLGEKLTDK EVDELFKEANVKSNGTINYEEFTQMVTLPPVDY NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggctaaattcttcacaccagttcaaatcaatgaatacaaggagtgcttctctctgtat gacaagaagcaaaagggcaagattgctgccaacgatctgatcacagtaatgcgctgcctg ggaacaagccccacgtttggggaaattgagagacatctacaagttcacaaaatcgaaaag acaggcgagctggacttctccacatttctgacgatgatgcacagacagatgcaacaggaa gaccccaaggcagaaatcctggaggcactgaggatgacagacaaacagaagaaaggctac atccaggcgtctgagctgcgggccaagctcaccaagttgggggagaaactcacagacaaa gaagtggatgaactcttcaaagaggcaaacgtcaagtcaaacgggaccatcaactatgag gagttcacccagatggtgacgctgccgcctgtcgattactga

DBGET integrated database retrieval system