Epinephelus lanceolatus (giant grouper): 117253557 Help Entry 117253557         CDS       T07331                                  Symbol ccl25b Name (RefSeq) C-C motif chemokine 25b   KO K13072   C-C motif chemokine 25 Organism ely  Epinephelus lanceolatus (giant grouper) Pathway ely04060   Cytokine-cytokine receptor interaction ely04672   Intestinal immune network for IgA production Brite KEGG Orthology (KO) [BR:ely00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     117253557 (ccl25b)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     117253557 (ccl25b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ely04052]     117253557 (ccl25b) Cytokines and neuropeptides [BR:ely04052]  Cytokines   Chemokines    117253557 (ccl25b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Peptidase_C65 Motif Other DBs NCBI-GeneID:  117253557 NCBI-ProteinID:  XP_033476974 LinkDB All DBs Position 5:29337502..29340958 Genome browser AA seq 96 aa AA seqDB search MKFQALFFLLLLTCMYLSLAQGSYGNCCLGYVTRMKANVRNNIESYRMQETDGDCNIRAV VFLMRKRPSHKKQRTVCANPNDIWVQGLMDSVDRKM NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaagttccaagctcttttcttccttctgctcctcacctgcatgtacctgagtcttgca caaggctcgtatggcaactgctgcctcggctacgttacgaggatgaaagcgaatgtgagg aataacattgaaagttacaggatgcaggaaacagatggtgactgcaacatcagagctgtt gtgttcctgatgaggaagaggccgtcacacaaaaaacagcggactgtttgtgccaatccc aatgacatttgggtccaggggctgatggatagcgtggataggaaaatgtag

DBGET integrated database retrieval system