Epinephelus lanceolatus (giant grouper): 117254997 Help Entry 117254997         CDS       T07331                                  Name (RefSeq) dynein light chain 4, axonemal   KO K10412   dynein axonemal light chain 4 Organism ely  Epinephelus lanceolatus (giant grouper) Pathway ely04814   Motor proteins Brite KEGG Orthology (KO) [BR:ely00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     117254997  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ely03037]     117254997    04812 Cytoskeleton proteins [BR:ely04812]     117254997 Cilium and associated proteins [BR:ely03037]  Motile cilia and associated proteins   Dynein arm    117254997 Cytoskeleton proteins [BR:ely04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      117254997 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Ground-like Motif Other DBs NCBI-GeneID:  117254997 NCBI-ProteinID:  XP_033479416 LinkDB All DBs Position 6:complement(9149108..9153688) Genome browser AA seq 106 aa AA seqDB search MAGTGEGKKEEADYKRLHSFPLIRHTDMPEEMRVETMELCVTACEKFATNNESAAKMIKE SMDKKFGSSWHVVIGEGFGFEVTHEVKNLLYMFFGGSLAVCVWKCS NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggctgggactggcgaggggaagaaagaggaggccgactacaagagactgcacagcttc cctctcatcaggcatacagatatgccagaggaaatgagggttgagacaatggagctttgt gttacagcctgcgaaaagtttgccaccaacaatgagagcgcagcgaagatgatcaaagag tccatggacaagaaattcggcagctcgtggcacgtggtgatcggtgagggctttggcttt gaggtcacgcacgaagtaaagaacctgctctacatgttctttggagggagtctggccgtg tgcgtgtggaagtgttcgtag

DBGET integrated database retrieval system