Epinephelus lanceolatus (giant grouper): 117257391 Help Entry 117257391         CDS       T07331                                  Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism ely  Epinephelus lanceolatus (giant grouper) Pathway ely04081   Hormone signaling ely04144   Endocytosis ely04150   mTOR signaling pathway ely04270   Vascular smooth muscle contraction ely04310   Wnt signaling pathway ely04350   TGF-beta signaling pathway ely04510   Focal adhesion ely04517   IgSF CAM signaling ely04520   Adherens junction ely04530   Tight junction ely04621   NOD-like receptor signaling pathway ely04625   C-type lectin receptor signaling pathway ely04810   Regulation of actin cytoskeleton ely05100   Bacterial invasion of epithelial cells ely05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ely00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     117257391    04350 TGF-beta signaling pathway     117257391    04150 mTOR signaling pathway     117257391   09133 Signaling molecules and interaction    04081 Hormone signaling     117257391    04517 IgSF CAM signaling     117257391  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     117257391   09144 Cellular community - eukaryotes    04510 Focal adhesion     117257391    04520 Adherens junction     117257391    04530 Tight junction     117257391   09142 Cell motility    04810 Regulation of actin cytoskeleton     117257391  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     117257391    04625 C-type lectin receptor signaling pathway     117257391   09153 Circulatory system    04270 Vascular smooth muscle contraction     117257391  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     117257391    05100 Bacterial invasion of epithelial cells     117257391  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ely04131]     117257391   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ely04147]     117257391    04031 GTP-binding proteins [BR:ely04031]     117257391 Membrane trafficking [BR:ely04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     117257391 Exosome [BR:ely04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    117257391   Exosomal proteins of other body fluids (saliva and urine)    117257391   Exosomal proteins of colorectal cancer cells    117257391   Exosomal proteins of bladder cancer cells    117257391 GTP-binding proteins [BR:ely04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     117257391 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  117257391 NCBI-ProteinID:  XP_033483446 LinkDB All DBs Position 7:26932462..26938454 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEDGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKSSKCVLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagcaatcaggaaaaagctggtcatagtgggagatggagcctgtgggaagacctgt ctgctcattgtgttcagtaaggaccagtttcctgaggtctatgtgcccactgtgtttgag aactacgttgctgacattgaagtcgatagcaaacaggtcgagttagcgctctgggataca gcaggtcaagaagactacgacagactgcgtccactctcctatccagacactgatgtcatt ctcatgtgcttttccatcgacagccctgacagtcttgagaatatccctgagaagtggact cctgaggtgaaacacttctgccctaatgttcccattatactagtgggaaataaaaaggac ctgcgtaacgatgagcacacccggagggagcttgccaaaatgaagcaggagcctgtgaaa ccagaggatggacgggacatggctaataggatcggtgcctttggatacatggagtgctct gcaaaaacaaaggatggcgtgagggaagtgttcgagatggccaccagggctgcactacag gccaggcggggaaagaagagcagtaaatgtgtcctactgtaa

DBGET integrated database retrieval system