Epinephelus lanceolatus (giant grouper): 117260914 Help Entry 117260914         CDS       T07331                                  Symbol apln Name (RefSeq) apelin   KO K05225   apelin Organism ely  Epinephelus lanceolatus (giant grouper) Pathway ely04080   Neuroactive ligand-receptor interaction ely04371   Apelin signaling pathway Brite KEGG Orthology (KO) [BR:ely00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     117260914 (apln)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     117260914 (apln)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ely04052]     117260914 (apln) Cytokines and neuropeptides [BR:ely04052]  Neuropeptides   GPCR binding    117260914 (apln) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Apelin TIM21 Motif Other DBs NCBI-GeneID:  117260914 NCBI-ProteinID:  XP_033488924 LinkDB All DBs Position 10:32163143..32189287 Genome browser AA seq 77 aa AA seqDB search MNVKILTLVIVLLVSLLCSASAGPMASTEHGRELEEAATVRKVVQQNPARAGQSHRPAGW KRRRPRPRLSHKGPMPF NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgaatgtgaagatcctgacgctggtgattgtgctcttggtgtctctgctgtgttctgcc agtgctggtcccatggcctccacggagcatggcagagagctggaagaggcggctacggtg agaaaagtggtccagcaaaaccctgcgagggccggtcagagccacagaccagccggctgg aagaggagacgcccacggccacgtctttcccacaaggggcccatgccgttctag

DBGET integrated database retrieval system