Epinephelus lanceolatus (giant grouper): 117261385 Help Entry 117261385         CDS       T07331                                  Symbol insb Name (RefSeq) preproinsulin b   KO K04526   insulin Organism ely  Epinephelus lanceolatus (giant grouper) Pathway ely04010   MAPK signaling pathway ely04068   FoxO signaling pathway ely04081   Hormone signaling ely04114   Oocyte meiosis ely04140   Autophagy - animal ely04150   mTOR signaling pathway ely04810   Regulation of actin cytoskeleton ely04910   Insulin signaling pathway ely04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:ely00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     117261385 (insb)    04068 FoxO signaling pathway     117261385 (insb)    04150 mTOR signaling pathway     117261385 (insb)   09133 Signaling molecules and interaction    04081 Hormone signaling     117261385 (insb)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     117261385 (insb)   09143 Cell growth and death    04114 Oocyte meiosis     117261385 (insb)   09142 Cell motility    04810 Regulation of actin cytoskeleton     117261385 (insb)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     117261385 (insb)    04914 Progesterone-mediated oocyte maturation     117261385 (insb)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ely04052]     117261385 (insb) Cytokines and neuropeptides [BR:ely04052]  Neuropeptides   Unclassified    117261385 (insb) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  117261385 NCBI-ProteinID:  XP_033489679 LinkDB All DBs Position 10:19913809..19914814 Genome browser AA seq 111 aa AA seqDB search MARVPCAASMLLLLALYSPGVTSTPAQHLCGSHLVDTLYFVCGERGFFSGPHRAHKRDLE HLLGFLSKRARQEQRLWRALSGRKELKVKRGIVEQCCHKPCSIYHLEGYCD NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggcgagggtaccatgtgcagcgtccatgctgttactgctggcgctctactcccctggg gtgacctccacccccgcccagcacctgtgtggctcccacctggtggataccctgtacttc gtatgtggagaacggggctttttctccggtccgcaccgagcccacaagcgggatctggag catctgcttgggttcctgtctaaaagggccagacaggagcagcggctgtggagggctctg tctggccgcaaagagctcaaggtgaagagaggcatcgtggagcagtgctgccataagcca tgcagcatttaccacctggagggctactgcgactga

DBGET integrated database retrieval system