Epinephelus lanceolatus (giant grouper): 117262369 Help Entry 117262369         CDS       T07331                                  Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism ely  Epinephelus lanceolatus (giant grouper) Pathway ely04010   MAPK signaling pathway ely04012   ErbB signaling pathway ely04068   FoxO signaling pathway ely04137   Mitophagy - animal ely04140   Autophagy - animal ely04144   Endocytosis ely04150   mTOR signaling pathway ely04210   Apoptosis ely04218   Cellular senescence ely04370   VEGF signaling pathway ely04371   Apelin signaling pathway ely04510   Focal adhesion ely04540   Gap junction ely04625   C-type lectin receptor signaling pathway ely04810   Regulation of actin cytoskeleton ely04910   Insulin signaling pathway ely04912   GnRH signaling pathway ely04916   Melanogenesis ely05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ely00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     117262369    04012 ErbB signaling pathway     117262369    04370 VEGF signaling pathway     117262369    04371 Apelin signaling pathway     117262369    04068 FoxO signaling pathway     117262369    04150 mTOR signaling pathway     117262369  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     117262369    04140 Autophagy - animal     117262369    04137 Mitophagy - animal     117262369   09143 Cell growth and death    04210 Apoptosis     117262369    04218 Cellular senescence     117262369   09144 Cellular community - eukaryotes    04510 Focal adhesion     117262369    04540 Gap junction     117262369   09142 Cell motility    04810 Regulation of actin cytoskeleton     117262369  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     117262369   09152 Endocrine system    04910 Insulin signaling pathway     117262369    04912 GnRH signaling pathway     117262369    04916 Melanogenesis     117262369  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     117262369  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ely04131]     117262369   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ely04147]     117262369    04031 GTP-binding proteins [BR:ely04031]     117262369 Membrane trafficking [BR:ely04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     117262369  Endocytosis   Macropinocytosis    Ras GTPases     117262369 Exosome [BR:ely04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    117262369   Exosomal proteins of colorectal cancer cells    117262369 GTP-binding proteins [BR:ely04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     117262369 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  117262369 NCBI-ProteinID:  XP_033491178 LinkDB All DBs Position 11:complement(1605100..1622458) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtacaagctggtggtggtgggagctggaggcgtgggcaagagtgcactcacc attcagctcatccagaaccactttgtggatgaatatgaccccaccatagaggactcgtac aggaaacaggtcgtgattgatggggagacctgcctgctagacatcctggacactgcaggt caagaggagtacagcgccatgagggatcagtacatgaggacaggagagggtttcctctgt gtcttcgccatcaataacactaagtctttcgaggacattcaccagtacagagaacagatt aaacgtgtaaaggactcagacgatgttcccatggtgcttgtgggcaacaaatgtgacctc ccggcacgcacggtggacacaaggcaagcccaggaacttgcccgctcctatggtatccct tacatcgagacctctgccaaaacacgacagggagtggaggacgccttctacacactggtt agggagatcagacagcataagcttaggaagctgaacccaccggatgaaagtggtcaagac tgtatgagctgtcgctgtgtggtatcgtga

DBGET integrated database retrieval system