Epinephelus lanceolatus (giant grouper): 117264394 Help Entry 117264394         CDS       T07331                                  Name (RefSeq) cystatin-B-like   KO K13907   cystatin-A/B Organism ely  Epinephelus lanceolatus (giant grouper) Brite KEGG Orthology (KO) [BR:ely00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:ely01002]     117264394   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ely04147]     117264394 Peptidases and inhibitors [BR:ely01002]  Peptidase inhibitors   Family I25: cystatin family    117264394 Exosome [BR:ely04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    117264394 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin Dynein_light Motif Other DBs NCBI-GeneID:  117264394 NCBI-ProteinID:  XP_033494202 LinkDB All DBs Position 13:23089411..23091435 Genome browser AA seq 100 aa AA seqDB search MPMKCGGTGPAADATEEIQKLCDEVKPSAEAKAGKTYDVFTAKSYTSQVVAGTNFFIKVH VGGDEHVHLRVFKPLPCNGGGPELSDMQHNKTHQDPVEYF NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgcctatgaaatgtggagggaccggcccggcagccgatgccaccgaagaaatccagaaa ctgtgtgatgaggtaaagcccagtgcggaggcaaaagcagggaagacttatgacgttttc acagccaagagctacacgagtcaagttgtggctgggaccaacttcttcatcaaggttcat gttggaggagacgaacatgttcacctccgtgttttcaaaccactgccatgtaatggagga ggacctgagctgagtgatatgcagcacaacaagacccaccaagaccctgttgagtacttc taa

DBGET integrated database retrieval system