Epinephelus lanceolatus (giant grouper): 117265792 Help Entry 117265792         CDS       T07331                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism ely  Epinephelus lanceolatus (giant grouper) Pathway ely04382   Cornified envelope formation ely05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ely00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     117265792  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     117265792  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ely04147]     117265792 Exosome [BR:ely04147]  Exosomal proteins   Exosomal proteins of microglial cells    117265792 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 DEK_C SPARC_Ca_bdg Motif Other DBs NCBI-GeneID:  117265792 NCBI-ProteinID:  XP_033496389 LinkDB All DBs Position 14:13354425..13356549 Genome browser AA seq 98 aa AA seqDB search MTELEKSMESLIMVFHRYAKEDGDEKTLTKKELKRLLEAELPTFLKAQKNPKTVDCILKD LDQNKDDKLDFEEFLPLVVGLSMACEKCYMLHEKKSKK NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgactgagttggagaagagcatggagtccctgattatggtgtttcaccgctatgccaaa gaagacggcgatgaaaagaccttaaccaagaaggaactgaaaagactattggaggcagag ttacccaccttcctgaaagcccagaagaaccccaaaactgtggactgcatcttgaaagat ttagaccaaaacaaagatgataagttggactttgaagagtttcttcccctcgtcgtcggc ctctcaatggcctgtgagaagtgttacatgctccatgagaagaagagcaagaagtga

DBGET integrated database retrieval system