Epinephelus lanceolatus (giant grouper): 117268625 Help Entry 117268625         CDS       T07331                                  Symbol dynll2b Name (RefSeq) dynein, light chain, LC8-type 2b   KO K10418   dynein light chain LC8-type Organism ely  Epinephelus lanceolatus (giant grouper) Pathway ely04814   Motor proteins ely05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ely00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     117268625 (dynll2b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     117268625 (dynll2b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ely03037]     117268625 (dynll2b)    04812 Cytoskeleton proteins [BR:ely04812]     117268625 (dynll2b) Cilium and associated proteins [BR:ely03037]  Motile cilia and associated proteins   Dynein arm    117268625 (dynll2b) Cytoskeleton proteins [BR:ely04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      117268625 (dynll2b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light SAM_5 Motif Other DBs NCBI-GeneID:  117268625 NCBI-ProteinID:  XP_033501125 LinkDB All DBs Position 2:17476185..17479118 Genome browser AA seq 89 aa AA seqDB search MTDRKAVIKNADMSEEMQQDAVDCAMQAMDKYNIEKDIAAFVKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactgacaggaaggcagtgataaagaatgcagacatgtctgaagagatgcagcaggat gctgtggactgtgccatgcaggctatggataagtacaacattgagaaggatatcgccgcc tttgtcaaaaaggagtttgacaagaagtacaaccccacatggcactgcatagtcgggagg aactttggcagctatgtgacgcatgagacgaagcatttcatctacttctatctgggccaa gtggccattctactcttcaagtcgggctga

DBGET integrated database retrieval system