Epinephelus lanceolatus (giant grouper): 117268625 Help Entry 117268625         CDS       T07331                                  Symbol dynll2b Name (RefSeq) dynein, light chain, LC8-type 2b   KO K10418   dynein light chain LC8-type Organism ely  Epinephelus lanceolatus (giant grouper) Pathway ely04517   IgSF CAM signaling ely04814   Motor proteins ely05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ely00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     117268625 (dynll2b)  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     117268625 (dynll2b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     117268625 (dynll2b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ely03037]     117268625 (dynll2b)    04812 Cytoskeleton proteins [BR:ely04812]     117268625 (dynll2b) Cilium and associated proteins [BR:ely03037]  Motile cilia and associated proteins   Dynein arm    117268625 (dynll2b) Cytoskeleton proteins [BR:ely04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      117268625 (dynll2b) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light SAM_5 Motif Other DBs NCBI-GeneID:  117268625 NCBI-ProteinID:  XP_033501125 LinkDB All DBs Position 11:complement(27660271..27663204) Genome browser AA seq 89 aa AA seqDB search MTDRKAVIKNADMSEEMQQDAVDCAMQAMDKYNIEKDIAAFVKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactgacaggaaggcagtgataaagaatgcagacatgtctgaagagatgcagcaggat gctgtggactgtgccatgcaggctatggataagtacaacattgagaaggatatcgccgcc tttgtcaaaaaggagtttgacaagaagtacaaccccacatggcactgcatagtcgggagg aactttggcagctatgtgacgcatgagacgaagcatttcatctacttctatctgggccaa gtggccattctactcttcaagtcgggctga

DBGET integrated database retrieval system