Epinephelus lanceolatus (giant grouper): 117269249 Help Entry 117269249         CDS       T07331                                  Name (RefSeq) histone H2A type 2-B-like   KO K11251   histone H2A Organism ely  Epinephelus lanceolatus (giant grouper) Pathway ely03082   ATP-dependent chromatin remodeling ely04217   Necroptosis Brite KEGG Orthology (KO) [BR:ely00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     117269249  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     117269249  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ely03036]     117269249   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ely04147]     117269249 Chromosome and associated proteins [BR:ely03036]  Eukaryotic type   Nucleosome assembly factors    Histones     117269249 Exosome [BR:ely04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    117269249 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  117269249 NCBI-ProteinID:  XP_033502044 LinkDB All DBs Position 2:254447..254843 Genome browser AA seq 120 aa AA seqDB search MSGRGGKTGKVKAKAKSRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgtcaggtcgtggaggaaaaactggaaaggtcaaggccaaggcgaagagccgctcatct cgtgccggacttcagttccctgttggccgtgtccacaggctcctgaggaaggggaactac gctcagcgggtcggtgccggagctccggtgtacctggcggcggtgctggagtatctgacc gctgagatcctggagctggctgggaacgctgcccgcgacaacaagaagaccaggatcatc ccccgtcacctgcagctggccgtccgcaacgacgaggagctcaacaagctgctgggcgga gtcaccatcgctcagggcggcgtgctgcccaacatccaggctgtgctgctgcccaagaag

DBGET integrated database retrieval system