Epinephelus lanceolatus (giant grouper): 117271248 Help Entry 117271248         CDS       T07331                                  Symbol rd3 Name (RefSeq) protein RD3   KO K25404   protein RD3 Organism ely  Epinephelus lanceolatus (giant grouper) Brite KEGG Orthology (KO) [BR:ely00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ely03037]     117271248 (rd3) Cilium and associated proteins [BR:ely03037]  Primary cilia and associated proteins   Other primary cilia associated proteins    117271248 (rd3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RD3 Motif Other DBs NCBI-GeneID:  117271248 NCBI-ProteinID:  XP_033505287 LinkDB All DBs Position 18:20831778..20835521 Genome browser AA seq 97 aa AA seqDB search MASWFSWNEPTHRSPQRDPADVVTDTLMLEFSWQLKEAERLQRERENEYRRLKTGVDYSW LANTPRSSYNISTGERLGLEELCSKLPPPCCGLVILK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atggcctcctggttcagctggaatgagccgactcacaggagcccccagcgggacccggca gacgtggtcaccgacaccctgatgctggagttcagctggcagctgaaggaggcggagagg ctgcagagagagagagagaacgaatacaggcgcctcaagaccggagtggactacagctgg ctggccaacacgcctcggtcctcctacaacatcagcaccggggagaggcttggtctggag gagctctgctccaagttgccgcctccctgctgcggcctggtcatactcaagtaa

DBGET integrated database retrieval system