Epinephelus lanceolatus (giant grouper): 117272819 Help Entry 117272819         CDS       T07331                                  Symbol txn Name (RefSeq) thioredoxin isoform X1   KO K03671   thioredoxin Organism ely  Epinephelus lanceolatus (giant grouper) Pathway ely04621   NOD-like receptor signaling pathway ely05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ely00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     117272819 (txn)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     117272819 (txn)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ely03110]     117272819 (txn) Chaperones and folding catalysts [BR:ely03110]  Protein folding catalysts   Protein disulfide isomerase    117272819 (txn) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin OST3_OST6 Thioredoxin_8 AhpC-TSA Thioredoxin_7 DIM1 Thioredoxin_2 Redoxin Thioredoxin_9 BrxC CjCas9_PI_CTD Choline_kinase Motif Other DBs NCBI-GeneID:  117272819 NCBI-ProteinID:  XP_033507788 LinkDB All DBs Position 20:27271579..27286579 Genome browser AA seq 108 aa AA seqDB search MVRHVETLEEFNAILKEAGDKLVVVDFTASWCGPCKQIGPHFDELSNKAENKNVIFLKVD VDEAQEVSEHCGIQCMPTFMFFKNGSKVFEFSGANKDTLTEKVVEFRT NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggttcgtcatgtggaaactttggaggaattcaatgcaatcctgaaggaagctggagac aagctggtggtggtggacttcacagcctcctggtgtggtccctgtaaacagattggccca cactttgacgaactgtcgaataaggctgaaaacaagaacgtgattttcctgaaggtggat gtggatgaagctcaggaggtgagtgaacattgcgggattcagtgcatgcccacattcatg tttttcaagaatggatcgaaggtgttcgagttctctggtgcaaacaaagatacactgact gaaaaagtggtagagttcagaacataa

DBGET integrated database retrieval system