Elizabethkingia sp. 2-6: FCS00_08455 Help Entry FCS00_08455       CDS       T06039                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism elz  Elizabethkingia sp. 2-6 Brite KEGG Orthology (KO) [BR:elz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:elz03032]     FCS00_08455    03036 Chromosome and associated proteins [BR:elz03036]     FCS00_08455    03400 DNA repair and recombination proteins [BR:elz03400]     FCS00_08455 DNA replication proteins [BR:elz03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     FCS00_08455 Chromosome and associated proteins [BR:elz03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     FCS00_08455 DNA repair and recombination proteins [BR:elz03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       FCS00_08455 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_bac_2 HU-HIG FtsL_2 Motif Other DBs NCBI-ProteinID:  QCO46406 UniProt:  A0ABD6YP84 LinkDB All DBs Position 1834832..1835119 Genome browser AA seq 95 aa AA seqDB search MNKSELIDAIAKDADITKVAAKKALESFISNVSSTLKKKDGKVSLVGFGTFSVAERAARQ GINPSTKKPIKIAAKKVAKFKAGSELAESVNGKKK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaacaagtctgaattaatcgacgcaattgcaaaggatgctgatatcactaaagtagca gctaagaaagcattagaatctttcatttctaatgtatcttctacattgaagaaaaaagat ggtaaagtatctttagtaggtttcggaactttctccgtagctgaaagagctgctagacaa ggtatcaacccttcaacaaagaaaccaattaaaatcgctgctaaaaaagtagctaagttt aaagctggttctgagttagcagaatctgtaaacggcaaaaagaaataa

DBGET integrated database retrieval system