KEGG   Euzebyella marina: D1013_16320
Entry
D1013_16320       CDS       T05677                                 
Name
(GenBank) ATP-dependent Clp protease adaptor ClpS
  KO
K06891  ATP-dependent Clp protease adaptor protein ClpS
Organism
emar  Euzebyella marina
Brite
KEGG Orthology (KO) [BR:emar00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    D1013_16320
SSDB
Motif
Pfam: ClpS PMI_typeI_C
Other DBs
NCBI-ProteinID: AYN69782
UniProt: A0A3G2LBY6
LinkDB
Position
complement(3809850..3810125)
AA seq 91 aa
MGLKEKYSEELLLEEAVVKQNEIILFNDDVNTFDHVIETLIDVCEHTPEQAEQCSIIVHY
NGKCTVKTGEYNDLKPRCSKLLQAGLNAEIV
NT seq 276 nt   +upstreamnt  +downstreamnt
atgggtttgaaagagaaatattctgaagaattacttttagaggaggcagttgtaaagcag
aacgaaattattctttttaatgatgatgtgaatactttcgatcatgtaatcgaaaccttg
atcgatgtgtgcgagcacacaccggaacaggccgagcaatgctctattattgttcattat
aacggaaaatgtactgtcaaaactggtgagtacaacgatttaaagccccgatgcagtaaa
ttgctacaggcgggccttaatgccgaaatcgtctaa

DBGET integrated database retrieval system