Eublepharis macularius (Leopard gecko): 129324311 Help Entry 129324311         CDS       T09084                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism emc  Eublepharis macularius (Leopard gecko) Pathway emc04010   MAPK signaling pathway emc04012   ErbB signaling pathway emc04068   FoxO signaling pathway emc04137   Mitophagy - animal emc04140   Autophagy - animal emc04144   Endocytosis emc04150   mTOR signaling pathway emc04210   Apoptosis emc04218   Cellular senescence emc04370   VEGF signaling pathway emc04371   Apelin signaling pathway emc04510   Focal adhesion emc04540   Gap junction emc04625   C-type lectin receptor signaling pathway emc04810   Regulation of actin cytoskeleton emc04910   Insulin signaling pathway emc04912   GnRH signaling pathway emc04916   Melanogenesis emc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:emc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     129324311 (HRAS)    04012 ErbB signaling pathway     129324311 (HRAS)    04370 VEGF signaling pathway     129324311 (HRAS)    04371 Apelin signaling pathway     129324311 (HRAS)    04068 FoxO signaling pathway     129324311 (HRAS)    04150 mTOR signaling pathway     129324311 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     129324311 (HRAS)    04140 Autophagy - animal     129324311 (HRAS)    04137 Mitophagy - animal     129324311 (HRAS)   09143 Cell growth and death    04210 Apoptosis     129324311 (HRAS)    04218 Cellular senescence     129324311 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     129324311 (HRAS)    04540 Gap junction     129324311 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     129324311 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     129324311 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     129324311 (HRAS)    04912 GnRH signaling pathway     129324311 (HRAS)    04916 Melanogenesis     129324311 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129324311 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:emc04131]     129324311 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:emc04147]     129324311 (HRAS)    04031 GTP-binding proteins [BR:emc04031]     129324311 (HRAS) Membrane trafficking [BR:emc04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     129324311 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     129324311 (HRAS) Exosome [BR:emc04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    129324311 (HRAS)   Exosomal proteins of colorectal cancer cells    129324311 (HRAS) GTP-binding proteins [BR:emc04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     129324311 (HRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin DUF6974 Ldh_1_N CbiA Motif Other DBs NCBI-GeneID:  129324311 NCBI-ProteinID:  XP_054827466 UniProt:  A0AA97IXT1 LinkDB All DBs Position 2:140064991..140185950 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtacaagctagtggtggttggagctggtggtgttgggaaaagtgctctgact attcagcttatccagaaccattttgttgatgaatacgatcctacaatagaggattcttac agaaagcaagtagtcattgatggagagacctgtttgttagacatcttggacacagcaggt caagaggagtacagtgccatgcgagaccaatacatgcgaacaggagaaggctttctttgt gtctttgccattaacaacaccaaatcctttgaagacattcatcagtacagggagcaaatc aagagagtgaaagactctgatgatgtccccatggtactggtggggaacaagtgtgacctt cccgcccgaactgtggaaacaaggcaagcccaagagctggcccggagctatgggattccc tacatagagacatcagccaaaactagacagggagttgaagatgccttctatactttagtg cgggaaatccggcagcacaaactacgcaagttgaaccccccagatgaaagcggcccaggc tgcatgaattgtaaatgtgttatatcatga

DBGET integrated database retrieval system