Eublepharis macularius (Leopard gecko): 129330049 Help Entry 129330049         CDS       T09084                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism emc  Eublepharis macularius (Leopard gecko) Pathway emc04010   MAPK signaling pathway emc04012   ErbB signaling pathway emc04068   FoxO signaling pathway emc04137   Mitophagy - animal emc04140   Autophagy - animal emc04150   mTOR signaling pathway emc04210   Apoptosis emc04218   Cellular senescence emc04370   VEGF signaling pathway emc04371   Apelin signaling pathway emc04540   Gap junction emc04625   C-type lectin receptor signaling pathway emc04810   Regulation of actin cytoskeleton emc04910   Insulin signaling pathway emc04912   GnRH signaling pathway emc04916   Melanogenesis Brite KEGG Orthology (KO) [BR:emc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     129330049 (NRAS)    04012 ErbB signaling pathway     129330049 (NRAS)    04370 VEGF signaling pathway     129330049 (NRAS)    04371 Apelin signaling pathway     129330049 (NRAS)    04068 FoxO signaling pathway     129330049 (NRAS)    04150 mTOR signaling pathway     129330049 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     129330049 (NRAS)    04137 Mitophagy - animal     129330049 (NRAS)   09143 Cell growth and death    04210 Apoptosis     129330049 (NRAS)    04218 Cellular senescence     129330049 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     129330049 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     129330049 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     129330049 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     129330049 (NRAS)    04912 GnRH signaling pathway     129330049 (NRAS)    04916 Melanogenesis     129330049 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:emc04131]     129330049 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:emc04147]     129330049 (NRAS)    04031 GTP-binding proteins [BR:emc04031]     129330049 (NRAS) Membrane trafficking [BR:emc04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     129330049 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     129330049 (NRAS) Exosome [BR:emc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129330049 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    129330049 (NRAS)   Exosomal proteins of breast cancer cells    129330049 (NRAS)   Exosomal proteins of colorectal cancer cells    129330049 (NRAS) GTP-binding proteins [BR:emc04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     129330049 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  129330049 NCBI-ProteinID:  XP_054835878 UniProt:  A0AA97KZA7 LinkDB All DBs Position 5:complement(126577858..126589210) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSEDVPMVLVGNKCDL PTRTVDTKQAHEIAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKRLSSSDDGNQG CMGLSCLVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaaactggtggtcgtgggagctggtggtgtcgggaaaagtgccctgacc atccaacttatccagaatcactttgtggatgaatatgatccaaccattgaggattcctat cggaagcaggtggttatcgatggggagacctgtttgctggacatcttggatacggctggg caagaggagtatagtgccatgagggaccagtatatgagaactggtgaaggctttctttgt gtgtttgccattaacaacagcaaatcgtttgcagacatcaatctttacagagagcagatt aagagagtaaaagattcagaagatgtaccaatggtattagtgggaaacaaatgtgactta ccaacacggacagtagacaccaagcaagctcatgaaatagccaagagctatgggatcccc ttcattgaaacatctgccaaaacaagacagggtgttgaagatgccttttacacactggtg agggaaattcgccaatatcggatgaaaagattgagcagcagtgacgacgggaatcaaggc tgcatggggctgtcgtgccttgtgatgtga

DBGET integrated database retrieval system