Eublepharis macularius (Leopard gecko): 129331869 Help Entry 129331869         CDS       T09084                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism emc  Eublepharis macularius (Leopard gecko) Pathway emc04810   Regulation of actin cytoskeleton emc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:emc00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     129331869 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129331869 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:emc04131]     129331869 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:emc04812]     129331869 (PFN2)    04147 Exosome [BR:emc04147]     129331869 (PFN2) Membrane trafficking [BR:emc04131]  Others   Actin-binding proteins    Others     129331869 (PFN2) Cytoskeleton proteins [BR:emc04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      129331869 (PFN2) Exosome [BR:emc04147]  Exosomal proteins   Proteins found in most exosomes    129331869 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  129331869 NCBI-ProteinID:  XP_054838470 UniProt:  A0AA97JIK4 LinkDB All DBs Position 6:36071197..36078125 Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGIFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggcaggctggcaaagctacgtggataacctgatgtgcgatggctgctgccaagaggcc gccattgtcggctactgcgacgccaagtacgtctgggcagccacggctgggggcatcttc cagagcattacgcctgtagaaatagatatgattgtaggaaaagatcgcgaaggtttcttc accaacggtctaactcttggtgcaaagaagtgttctgtgatcagagatagcctctatgtg gacggtgactgcacaatggacatcaggacaaagagtcaaggtggcgagccaacatataat gttgctgtaggcagagctggccgagtcttggtctttgtaatgggcaaggaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system