Eublepharis macularius (Leopard gecko): 129338419 Help Entry 129338419         CDS       T09084                                  Name (RefSeq) C-X-C motif chemokine 2-like   KO K10030   interleukin 8 Organism emc  Eublepharis macularius (Leopard gecko) Pathway emc04060   Cytokine-cytokine receptor interaction emc04218   Cellular senescence emc04620   Toll-like receptor signaling pathway emc04621   NOD-like receptor signaling pathway emc04622   RIG-I-like receptor signaling pathway emc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:emc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     129338419  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     129338419  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     129338419    04621 NOD-like receptor signaling pathway     129338419    04622 RIG-I-like receptor signaling pathway     129338419  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129338419  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:emc04052]     129338419    00536 Glycosaminoglycan binding proteins [BR:emc00536]     129338419 Cytokines and neuropeptides [BR:emc04052]  Cytokines   Chemokines    129338419 Glycosaminoglycan binding proteins [BR:emc00536]  Heparan sulfate / Heparin   Chemokines    129338419 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  129338419 NCBI-ProteinID:  XP_054848610 UniProt:  A0AA97K2I4 LinkDB All DBs Position 12:48953779..48958558 Genome browser AA seq 102 aa AA seqDB search MSLCRRVALTLLFALLAGSLLQSRAAPLTGELRCQCVELFSGRIPMKLFARINLYPPGPH CANTEVIATTTEGREVCLDPEAPWVKMAVKRILEKNKERNQP NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgagtctctgccgccgagttgccctgaccctcctcttcgccctgctggctgggagcctc ttgcaaagccgagctgcccccttgaccggggaactgcgctgtcagtgtgtcgagttgttt tctggccggatccctatgaaactctttgcccggataaatctctatcccccagggcctcac tgcgccaacactgaagtcatagccaccacaacagaagggagagaagtctgcctggaccct gaggctccttgggttaaaatggctgtcaaaaggattctggaaaagaataaagaaaggaac cagccatga

DBGET integrated database retrieval system