Eublepharis macularius (Leopard gecko): 129338690 Help Entry 129338690         CDS       T09084                                  Symbol MYL11 Name (RefSeq) myosin regulatory light chain 11   KO K12758   fast skeletal myosin light chain 2 Organism emc  Eublepharis macularius (Leopard gecko) Pathway emc04510   Focal adhesion emc04520   Adherens junction emc04810   Regulation of actin cytoskeleton emc04814   Motor proteins emc04820   Cytoskeleton in muscle cells emc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:emc00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     129338690 (MYL11)    04520 Adherens junction     129338690 (MYL11)   09142 Cell motility    04814 Motor proteins     129338690 (MYL11)    04820 Cytoskeleton in muscle cells     129338690 (MYL11)    04810 Regulation of actin cytoskeleton     129338690 (MYL11)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129338690 (MYL11)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:emc04812]     129338690 (MYL11)    04147 Exosome [BR:emc04147]     129338690 (MYL11) Cytoskeleton proteins [BR:emc04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      129338690 (MYL11) Exosome [BR:emc04147]  Exosomal proteins   Exosomal proteins of hepatic cells    129338690 (MYL11) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF_EFCAB10_C AIF-1 Motif Other DBs NCBI-GeneID:  129338690 NCBI-ProteinID:  XP_054849083 UniProt:  A0AA97K2X4 LinkDB All DBs Position 12:64076353..64086145 Genome browser AA seq 170 aa AA seqDB search MAPKKAKRRAAAEGGSSNVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFGAMGR LNVKNEELESMIKEASGPINFTVFLTMFGEKLKGADPEDVIMAAFKVLDPDGKGTVKKQF LEELLTTQCDRFTPEEIKNMWHAFPPDVAGNVDYKNICYVITHGEDKEGE NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atggcacccaagaaggcaaagagaagggcagcagccgaaggaggaagctccaacgttttc tccatgtttgaccaaacacagatccaggagttcaaagaggccttcactgtcattgaccag aacagagatggcatcattgacaaggaagacctgagagacacattcggtgctatggggcgc ctaaacgtgaaaaatgaggagctggaatcaatgatcaaagaggccagtggcccaatcaac ttcaccgtcttcctcaccatgtttggggagaagctgaagggtgcggatcccgaggacgta atcatggccgccttcaaagtcctggaccctgacggcaagggcaccgtcaagaagcaattc ttggaagaactcctgaccacccaatgtgaccggttcaccccagaagagatcaagaacatg tggcacgctttccctccagatgtcgctggcaatgtcgactacaagaatatttgttacgtc atcacacacggagaggacaaggaaggggaataa

DBGET integrated database retrieval system