Eublepharis macularius (Leopard gecko): 129345177 Help Entry 129345177         CDS       T09084                                  Name (RefSeq) cystatin-B-like   KO K13907   cystatin-A/B Organism emc  Eublepharis macularius (Leopard gecko) Brite KEGG Orthology (KO) [BR:emc00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:emc01002]     129345177   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:emc04147]     129345177 Peptidases and inhibitors [BR:emc01002]  Peptidase inhibitors   Family I25: cystatin family    129345177 Exosome [BR:emc04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    129345177 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin PhosphMutase Motif Other DBs NCBI-GeneID:  129345177 NCBI-ProteinID:  XP_054858148 UniProt:  A0AA97KK61 LinkDB All DBs Position 18:4723949..4730588 Genome browser AA seq 99 aa AA seqDB search MLCGAVSSEPKAATAETQQLVQAVKAEVEEKEGKSFDVFSAVEFKTQMVAGINYFIKVQT GNDEYIHLRIHKSLPHENKPPKLTSYQSNKGKLEELSYF NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgctgtgcggcgcggtgagcagcgagcccaaggcggccacggccgagacgcagcagctg gtgcaagcggtgaaggcagaggtagaagagaaagaagggaagagctttgacgtcttcagt gcagtagagtttaaaacacagatggttgctggaataaactacttcataaaggtccaaact ggcaatgatgaatacattcacctacgaattcacaaaagccttcctcatgaaaacaaacca ccgaagctcaccagttaccaaagcaacaagggaaagcttgaggagctatcttacttctag

DBGET integrated database retrieval system