Eublepharis macularius (Leopard gecko): 129346045 Help Entry 129346045         CDS       T09084                                  Name (RefSeq) histone H2A type 2-C   KO K11251   histone H2A Organism emc  Eublepharis macularius (Leopard gecko) Pathway emc03082   ATP-dependent chromatin remodeling emc04217   Necroptosis Brite KEGG Orthology (KO) [BR:emc00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     129346045  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     129346045  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:emc03036]     129346045   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:emc04147]     129346045 Chromosome and associated proteins [BR:emc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     129346045 Exosome [BR:emc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129346045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  129346045 NCBI-ProteinID:  XP_054859273 UniProt:  A0AA97KMH1 LinkDB All DBs Position 19:11967719..11968146 Genome browser AA seq 129 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHKAKGK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtctggccgcggcaagcaaggcggaaaggcgagagccaaggccaagtcgcgctcctcc cgcgccggcttgcagttccccgtgggccgcgtccaccgtctcttgcgcaaaggcaactac gccgagcgcgtcggcgccggagctcccgtctacctggccgccgtgctggagtacctgacg gccgagatcctcgagctggcgggcaacgccgcccgcgacaacaagaagacccgcatcatc ccccgccacctgcagctggccatccgcaacgacgaggagctcaacaaactcctgggcaaa gtcaccatcgctcaaggaggcgtcctgcccaacatccaggccgtcctcctgcccaagaag accgaaagccacaaggccaagggcaaataa

DBGET integrated database retrieval system