Eublepharis macularius (Leopard gecko): 129346103 Help Entry 129346103         CDS       T09084                                  Name (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism emc  Eublepharis macularius (Leopard gecko) Pathway emc04081   Hormone signaling emc04144   Endocytosis emc04150   mTOR signaling pathway emc04270   Vascular smooth muscle contraction emc04310   Wnt signaling pathway emc04350   TGF-beta signaling pathway emc04510   Focal adhesion emc04517   IgSF CAM signaling emc04519   Cadherin signaling emc04520   Adherens junction emc04530   Tight junction emc04621   NOD-like receptor signaling pathway emc04625   C-type lectin receptor signaling pathway emc04810   Regulation of actin cytoskeleton emc05100   Bacterial invasion of epithelial cells emc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:emc00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     129346103    04350 TGF-beta signaling pathway     129346103    04150 mTOR signaling pathway     129346103   09133 Signaling molecules and interaction    04081 Hormone signaling     129346103    04517 IgSF CAM signaling     129346103    04519 Cadherin signaling     129346103  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     129346103   09144 Cellular community - eukaryotes    04510 Focal adhesion     129346103    04520 Adherens junction     129346103    04530 Tight junction     129346103   09142 Cell motility    04810 Regulation of actin cytoskeleton     129346103  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     129346103    04625 C-type lectin receptor signaling pathway     129346103   09153 Circulatory system    04270 Vascular smooth muscle contraction     129346103  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129346103    05100 Bacterial invasion of epithelial cells     129346103  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:emc04131]     129346103   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:emc04147]     129346103    04031 GTP-binding proteins [BR:emc04031]     129346103 Membrane trafficking [BR:emc04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     129346103 Exosome [BR:emc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129346103   Exosomal proteins of other body fluids (saliva and urine)    129346103   Exosomal proteins of colorectal cancer cells    129346103   Exosomal proteins of bladder cancer cells    129346103 GTP-binding proteins [BR:emc04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     129346103 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  129346103 NCBI-ProteinID:  XP_054859357 UniProt:  A0AA97KQ54 LinkDB All DBs Position 19:14706390..14718840 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRISAFGYLECSAKTKDGVREVFEMATRAALQ AKRGRKKTSCQLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatacgcaagaagctcgtcattgtaggagatggagcttgtgggaagacctgt ctccttattgttttcagcaaggaccagttcccagaggtgtatgtccccactgtcttcgag aactatgtggccgacattgaggtggatggaaagcaggtagaacttgctctgtgggatact gcgggccaagaggattatgaccgcctgagacccctgtcttaccctgacacagatgtcatc ctcatgtgcttctccatcgacagccctgacagtttagagaatatccccgagaagtggact ccggaggtgaagcacttctgtcccaatgtgcctatcattctggtggggaacaagaaagat ctgcgtaacgacgagcacacacgccgggagctggctaagatgaagcaggagccagtgaag cccgaggagggccgggacatggccaacaggattagtgcttttggatacctggaatgctct gcgaagacaaaggatggcgtgcgggaagtgtttgagatggccacccgggctgccttgcag gccaagcgggggcgtaagaagacctcgtgccagctgctgtaa

DBGET integrated database retrieval system