Entomomonas moraniae: DM558_05075 Help Entry DM558_05075       CDS       T06727                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism emo  Entomomonas moraniae Pathway emo01100   Metabolic pathways emo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:emo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DM558_05075    00074 Mycolic acid biosynthesis     DM558_05075   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DM558_05075 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AZS50187 UniProt:  A0A3Q9JLZ5 LinkDB All DBs Position complement(1062429..1062695) Genome browser AA seq 88 aa AA seqDB search MQILSAEIKQLIIHTLNLEDLTPEQIDDHAPLFNEGLGLDSIDALELGLALKSKYNIVLS PESEDTKKHFYSIASLVDFVNSQVVARG NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgcaaatattatcagctgaaataaagcaacttattattcataccctcaatttagaagat ttaacacctgaacaaatagacgatcatgcgcctttatttaatgaggggttgggcttggac tctattgatgctttggagcttgggcttgcattaaagtcgaagtataacattgttttatca ccggagagtgaggatactaaaaagcatttttactctattgcaagtttagtcgattttgtt aatagtcaggttgtagcaagaggataa

DBGET integrated database retrieval system