KEGG   Enterobacter mori: L6Y89_22190
Entry
L6Y89_22190       CDS       T08239                                 
Symbol
ravA
Name
(GenBank) ATPase RavA
  KO
K03924  MoxR-like ATPase [EC:3.6.3.-]
Organism
emor  Enterobacter mori
Brite
KEGG Orthology (KO) [BR:emor00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    L6Y89_22190 (ravA)
SSDB
Motif
Pfam: bpMoxR LARA_dom AAA_5 ATPase_RavA_C AAA_lid_8 AAA_3 Mg_chelatase Sigma54_activat AAA AAA_16 IstB_IS21 AAA_2
Other DBs
NCBI-ProteinID: UKJ21399
LinkDB
Position
4694329..4695825
AA seq 498 aa
MAHSHLLAERISRLSSALEKGLYERSHAIRLCLLAALSGESVFLLGPPGIAKSLIARRLK
FAFQNARAFEYLMTRFSTPEEVFGPLSIQALKDEGRYERLTAGYLPEAEIVFLDEIWKAG
PAILNTLLTAINERRFRNGASEEKIPMRLLVAASNELPEADSSLEALYDRMLIRLWLDKV
QDKSNFRSLLISQQDENENPVSASLQVTDEEYHQWQQDIGKITLPDAVFELIFMLRQQLD
LLPAAPYVSDRRWKKAIRLLQASALFSGRDAVAPIDLILLKDCLWHDAEGMNLMQQQLEI
LMTGHAWGQQAMLNQLGAIAQRRIQLQQQQSDKTALKVNRLGGMFSRKPHYELPADLTGT
TLTLLLQQPLKLHDMQVVHVTIERETLAQWLDKGGEIRGKLNGIGFAQPLTMEVDSSQHL
LIRDVSLQGSRLALPGTASDSVPEEIKQQLEALDTEWHQQHTRFSEQQKCLFIHSDWLGR
IEASLQDVSAQIKQARQC
NT seq 1497 nt   +upstreamnt  +downstreamnt
atggctcactcacatttattagcagaaagaatttcccgcctcagcagcgcgctggagaaa
ggcctttacgagcgtagccacgccattcgcctctgtctactggcggcattgagcggtgaa
agcgtgtttttgctgggtccaccgggcattgccaaaagcctgatcgcccgcaggctcaaa
tttgcgtttcagaacgcccgcgccttcgaatatctcatgacccgcttttccactcccgaa
gaagtgtttggtccgctttccattcaggcgctgaaagatgaagggcgctatgagcgtttg
acggcggggtatctgccagaggctgaaattgtctttcttgatgagatctggaaagccggc
ccggcgattctgaataccctgctgacggcgattaacgaacgtcggttccgcaacggtgcc
agcgaagagaaaatcccgatgcgcctgctggtggcggcctccaacgaactgcctgaagcc
gacagcagcctggaagcgctgtatgaccgcatgttgatccgcctgtggctggacaaagtg
caggataaatcaaatttccgctccctgctgataagccagcaggatgagaacgagaatccg
gtgtctgcttcgctgcaggtcaccgatgaggagtatcaccagtggcaacaggatatcggc
aaaatcaccctgcccgacgcggtctttgagctgatcttcatgctgcgccaacagcttgat
ttgctgcctgctgcaccttacgtctctgaccgtcgctggaaaaaagcgatccgtctgttg
caggccagcgccttgttcagcggtcgtgatgccgttgcgccaatcgatctcatcctgcta
aaagactgcctgtggcacgatgccgaagggatgaatttgatgcagcagcagcttgaaata
ttgatgaccggccacgcctgggggcagcaggcgatgctcaaccagctgggggcgattgcc
cagcggcgcatccagcttcagcagcagcaaagtgataaaaccgcgctgaaagtgaatcgc
cttggtggcatgttctcccgcaaaccgcattatgagcttccagccgatctgactggtacg
acgctcacgctgctgctccagcagccgctcaaactgcacgatatgcaggtggttcacgtt
acgattgagcgcgaaacgctggcgcagtggctcgataagggcggtgagatccgcggcaag
ctcaacggtattggttttgcccagccgctgacgatggaagtggatagcagccagcatctg
ctgatccgcgatgtcagcctgcaaggttcgcgtctggcgctgccgggcaccgcttcggat
agcgtgccggaagagatcaagcagcagctggaagcgctggatacggaatggcaccagcag
cacacgcgcttcagcgagcagcaaaaatgcctctttattcatagcgactggttaggtcgt
atcgaagccagcctgcaggacgtcagcgcgcagatcaaacaggcgcgtcaatgctaa

DBGET integrated database retrieval system