Endozoicomonas montiporae: EZMO1_0105 Help Entry EZMO1_0105        CDS       T09822                                  Symbol acp1 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism emp  Endozoicomonas montiporae Pathway emp01100   Metabolic pathways emp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:emp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EZMO1_0105 (acp1)    00074 Mycolic acid biosynthesis     EZMO1_0105 (acp1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EZMO1_0105 (acp1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AMO54377 UniProt:  A0A142B6K1 LinkDB All DBs Position 109173..109421 Genome browser AA seq 82 aa AA seqDB search MTIFETLATIISDVLDEDDLEITPQTVADDAEDWDSLAQIQIIHAIEHELKIKFSLQEIE QLNHAGNVGDTVELISKKIEAS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgacaattttcgaaacactcgccactattatcagtgatgtactggatgaagacgatctg gagataacccctcaaacggtggcagacgatgctgaagactgggattctctggcacagatt caaatcattcatgcgatagagcatgagctgaaaatcaagttcagcctgcaggagatcgaa caactcaatcatgccggtaacgtaggcgacaccgttgaattaatttctaaaaaaatagaa gcctcataa

DBGET integrated database retrieval system