Endozoicomonas montiporae: EZMO1_4387 Help Entry EZMO1_4387        CDS       T09822                                  Symbol xseB Name (GenBank) exonuclease VII, small subunit   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism emp  Endozoicomonas montiporae Pathway emp03430   Mismatch repair Brite KEGG Orthology (KO) [BR:emp00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     EZMO1_4387 (xseB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:emp03400]     EZMO1_4387 (xseB) Enzymes [BR:emp01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      EZMO1_4387 (xseB) DNA repair and recombination proteins [BR:emp03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      EZMO1_4387 (xseB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S Vps53_N TACC_C FlgN GIT_CC DUF4164 SKA1 FapA DUF2229 Motif Other DBs NCBI-ProteinID:  AMO58303 UniProt:  A0A142BHS7 LinkDB All DBs Position 4824321..4824563 Genome browser AA seq 80 aa AA seqDB search MSEKNQGFAFEKSLSELESLVQQMESGDLTLEQSLKAFEKGVKLTRECQQALSQAEQTVQ QLLDNNGQLETRPFEPSEGE NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtcagaaaaaaaccagggctttgcctttgaaaaatcactcagtgagctggaatcattg gttcaacaaatggaatccggagatctgacactggaacaatcattgaaggcgttcgaaaag ggcgtcaagctcacccgtgaatgccagcaagcgctgagtcaggcagaacaaactgttcaa cagctgctggataataacggtcaactggaaacccggcctttcgaaccgtccgaaggggaa tag

DBGET integrated database retrieval system