Sinorhizobium mexicanum: FKV68_07875 Help Entry FKV68_07875       CDS       T06706                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism emx  Sinorhizobium mexicanum Pathway emx02024   Quorum sensing emx03018   RNA degradation Brite KEGG Orthology (KO) [BR:emx00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     FKV68_07875 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     FKV68_07875 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:emx03019]     FKV68_07875 (hfq)    03036 Chromosome and associated proteins [BR:emx03036]     FKV68_07875 (hfq) Messenger RNA biogenesis [BR:emx03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      FKV68_07875 (hfq) Chromosome and associated proteins [BR:emx03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     FKV68_07875 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  QLL61375 UniProt:  A0A859QGC0 LinkDB All DBs Position 1636789..1637031 Genome browser AA seq 80 aa AA seqDB search MAERSQNLQDLFLNTVRKQKISLTIFLINGVKLTGVVTSFDNFCVLLRRDGHSQLVYKHA ISTIMPGQPLQMFENEEAAS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggcggaacgttctcaaaacttgcaggatctctttctcaatacggtccgcaagcaaaag atttcattgactattttcctgatcaacggtgtcaagctgacaggtgtggtcacatctttt gacaatttctgtgtattgctacgccgcgacggtcattctcagctcgtctacaagcacgcc atctcgacgatcatgccgggtcagcccttgcagatgttcgagaatgaggaagccgcatcc tga

DBGET integrated database retrieval system