KEGG   Escherichia coli NA114 (UPEC): ECNA114_1704
Entry
ECNA114_1704      CDS       T01998                                 
Name
(GenBank) Putative transport protein
  KO
K19577  MFS transporter, DHA1 family, inner membrane transport protein
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ena02000]
    ECNA114_1704
Transporters [BR:ena02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    ECNA114_1704
SSDB
Motif
Pfam: MFS_1 MFS_4 Sugar_tr
Other DBs
NCBI-ProteinID: AEG36532
LinkDB
Position
complement(1712325..1713494)
AA seq 389 aa
MKINYPLLALAIGAFGIGTTEFSPMGLLPVIARGVDVSIPAAGMLISAYAVGVMVGAPLM
TLLLSHRARRSALIFLMAIFTLGNVLSAIAPDYMTLMLSRILTSLNHGAFFGLGSVVAAS
VVPKHKQASAVATMFMGLTLANIGGVPAATWLGETIGWRMSFLATAGLGVISMVSLFLSL
PKGGAGARPEVKKELAVLMRPQVLSALLTTVLGAGAMFTLYTYISPVLQSITHVTPVFVT
AMLVLIGVGFSIGNYLGGKLADRSVNGTLKGFLLLLMVIMLAIPFLARNEFGAAISMVVW
GAATFAIVPPLQMRVMRVASEAPGLSSSVNIGAFNLGNALGAAAGGAVISAGLGYSFVPV
MGAIVAGLALLLVFMSARKQPEAVCVANS
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgaaaattaactatccgttgctggcgctggcgattggcgcgtttggtatcgggacaacg
gagttctcgccaatgggcttgttgcccgtcattgcgcgcggtgtggatgtctcgattccc
gctgccggaatgttaatcagtgcttatgcagttggcgtaatggttggcgcgccgctgatg
acgcttctactttctcatcgtgcccgccgcagtgcgttgattttcctgatggcgattttc
acgcttggcaacgtactttccgccatcgcgccggattatatgaccctgatgctttcacgc
attttgaccagcctgaatcacggggcattttttggtttgggttcagtcgtggccgcaagc
gtagtgccaaaacataaacaggccagcgcagttgccactatgtttatggggttaaccctg
gcaaatatcggtggcgtgccggcggcgacctggttgggcgaaaccatcggctggcggatg
tcatttctggcaacagcggggctgggcgtgatttcaatggtaagtctgttcctctcatta
cctaaaggtggcgcaggggcgcgacctgaagtgaaaaaagagctggcggtattaatgcgt
ccgcaggtgctgtctgcattgctgacgacggtactgggcgctggtgcaatgtttaccctc
tacacctatatctctccggtactgcaaagcattacccacgtaacgccggtgttcgtcacg
gcaatgctggtgctgattggtgtcggattctctatcggtaactatctcggcggcaaactg
gcagatcgttcagttaacggcacgttgaaaggctttttgttgttgctgatggtgattatg
ctggcaatcccgttcctggcccgcaatgagttcggcgcagctattagcatggtggtgtgg
ggagctgcaacctttgcgatcgtaccgccgttacagatgcgcgtgatgcgtgtcgccagt
gaagcgccaggtctgtcttcatcagtcaatattggtgcctttaatcttggaaatgcgctg
ggagcagctgctggtggtgcggtaatttccgctgggctgggatacagttttgtgccggtg
atgggggcgattgtcgcgggactggcattattgctggtgtttatgtcagccagaaaacaa
cctgaagcagtttgcgttgccaacagctaa

DBGET integrated database retrieval system