Escherichia coli NA114 (UPEC): ECNA114_3060 Help Entry ECNA114_3060      CDS       T01998                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism ena  Escherichia coli NA114 (UPEC) Pathway ena01100   Metabolic pathways ena01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ena00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ECNA114_3060    00074 Mycolic acid biosynthesis     ECNA114_3060   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ECNA114_3060 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 BH4 Motif Other DBs NCBI-ProteinID:  AEG37899 LinkDB All DBs Position 3143628..3143876 Genome browser AA seq 82 aa AA seqDB search MVNREIVMDYILSCLQDLVENGVEIKPDSDLVNDLGLESIKVMDLLMMLEDRFDISIPIN ILLDVKTPAQLMETLLPWLENK NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggtaaatcgtgaaatagtaatggattacatcctttcctgtttacaggatttggtcgaa aacggtgtggaaattaagcccgacagcgatctcgtcaacgatcttggcctggagtcgatc aaagtgatggatctcttaatgatgctggaagacagattcgatatttccattcctattaat attctgctggatgtcaaaacccctgcgcaattaatggaaactctacttccatggctggag aataaataa

DBGET integrated database retrieval system