KEGG   Escherichia coli NA114 (UPEC): ECNA114_4485
Entry
ECNA114_4485      CDS       T01998                                 
Symbol
yjgP
Name
(GenBank) Putative permease
  KO
K07091  lipopolysaccharide export system permease protein
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ena00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ECNA114_4485 (yjgP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ena02000]
    ECNA114_4485 (yjgP)
Transporters [BR:ena02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter
    ECNA114_4485 (yjgP)
SSDB
Motif
Pfam: LptF_LptG HemY_N
Other DBs
NCBI-ProteinID: AEG39334
LinkDB
Position
4638658..4639665
AA seq 335 aa
MRILGAAVDGDIPANLVLSLLGLGVPEMAQLILPLSLFLGLLMTLGKLYTESEITVMHAC
GLSKAVLVKAAMILAVFTAIVAAVNVMWAGPWSSRHQDEVLAEAKANPGMAALAQGQFQQ
ATNGSSVLFIESVDGSDFKDVFLAQIRPKGNARPSVVVADSGHLTQLRDGSQVVTLNQGT
RFEGTALLRDFRITDFQDYQAIIGHQAVALDPNDTDQMDMRTLWNTDTDRARAELNWRIT
LVFTVFMMALMVVPLSVVNPRQGRVLSMLPAMLLYLLFFLIQTSLKSNGGKGKLDPTLWM
WTVNLIYLALAIVLNLWDTVPVRRLRASFSRKGAV
NT seq 1008 nt   +upstreamnt  +downstreamnt
gtgaggatcctcggcgcagcggttgacggcgatattccggcgaatctggtgctctccctt
ctcgggttgggcgtgccggaaatggcgcagcttatcctgccattaagcctgttcctcggg
ctgctgatgacgctgggcaaactgtataccgaaagtgaaattacggtaatgcatgcctgc
ggcctgagcaaagcggttctggtgaaagcggcaatgatccttgcggtattcacggcaatc
gtcgcggcggttaacgtgatgtgggcgggaccgtggtcatcgcgtcatcaggatgaagtg
ttagcagaagcgaaagcgaaccctggcatggcggcgctggcgcaagggcaattccagcaa
gcgactaatggcagctcggtgctgttcatcgaaagcgttgacggcagcgatttcaaagat
gtgttcctcgcacaaattcgaccaaaaggtaatgcacgaccttctgtggtggtggccgat
tccggacatttaacccagctgcgcgacggctcccaggtcgtcactctcaaccagggaacg
cgcttcgaaggcactgcactgttacgtgatttccgcattacggatttccaggattatcag
gcgatcattggtcaccaggcggtggcgctcgacccgaacgataccgaccagatggacatg
cgcacattgtggaacactgacaccgatcgtgcccgcgcagaactgaactggcgtatcacg
ttggtattcaccgtgtttatgatggcacttatggttgtaccgttgagcgtggttaacccg
cgtcagggacgcgtactgtcgatgctgccagccatgctgctgtatctacttttcttcctg
atccagacctccctgaaatcgaacggcggtaaaggtaagctggacccgacgctgtggatg
tggaccgttaacctgatttatctggctttggcgattgttctcaacctttgggacactgtg
ccggtccgccgcctgcgcgccagtttttcgcgtaaaggagcggtgtga

DBGET integrated database retrieval system