Enterobacter sp. N18-03635: ELK40_08950 Help Entry ELK40_08950       CDS       T08394                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism enb  Enterobacter sp. N18-03635 Pathway enb01100   Metabolic pathways enb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:enb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ELK40_08950    00074 Mycolic acid biosynthesis     ELK40_08950   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ELK40_08950 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 HLH Motif Other DBs NCBI-ProteinID:  AZV05242 LinkDB All DBs Position 1726607..1726843 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVVNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttgtgaactccgcttccttcgttgaagacctgggcgcagattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaagatcaccaccgttcaggctgccattgattacatcaacggtcaccaggcgtaa

DBGET integrated database retrieval system