Enterobacter sp. FY-07: AKI40_2187 Help Entry AKI40_2187        CDS       T04405                                  Name (GenBank) Cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism enf  Enterobacter sp. FY-07 Pathway enf00190   Oxidative phosphorylation enf01100   Metabolic pathways enf02020   Two-component system Module enf_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:enf00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     AKI40_2187  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     AKI40_2187 Enzymes [BR:enf01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      AKI40_2187 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AMO48590 LinkDB All DBs Position 2208424..2208537 Genome browser AA seq 37 aa AA seqDB search MWYFAWILGTLLACAFGVITALALEHVEATKAGKEEH NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcatggattttaggaacgcttcttgcctgtgcttttggagtaattacc gcgctggcgctggaacacgttgaagcgaccaaagccgggaaagaagaacattga

DBGET integrated database retrieval system