Euhalothece natronophila: FRE64_10025 Help Entry FRE64_10025       CDS       T06117                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism enn  Euhalothece natronophila Pathway enn01100   Metabolic pathways enn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:enn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FRE64_10025 (acpP)    00074 Mycolic acid biosynthesis     FRE64_10025 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FRE64_10025 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF7127 PI3K_P85_iSH2 DUF1493 Motif Other DBs NCBI-ProteinID:  QDZ40258 UniProt:  A0A5B8NMN2 LinkDB All DBs Position 2060005..2060259 Genome browser AA seq 84 aa AA seqDB search MNQEIFNKVQSIVAEQLEIQDKETIKPESKFAEDLGADSLDVVELVMALEEEFDLEIPDE DAEQIATVQAAVDYIDQKAATPSS NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaatcaggaaatttttaacaaagttcaaagcattgttgccgaacaactagaaattcaa gacaaagaaaccattaagccagaatcaaagtttgctgaggacttaggggcagactccctt gatgtggtagaacttgtgatggcgctcgaagaagagtttgatcttgaaattccagatgaa gatgcggaacaaattgccacagttcaagcagctgtagattatatcgatcaaaaagccgct actccttcttcttag

DBGET integrated database retrieval system