Enterobacter kobei ENHKU01: ECENHK_06660 Help Entry ECENHK_06660      CDS       T02315                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism eno  Enterobacter kobei ENHKU01 Pathway eno00190   Oxidative phosphorylation eno01100   Metabolic pathways eno02020   Two-component system Module eno_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:eno00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     ECENHK_06660  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     ECENHK_06660 Enzymes [BR:eno01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      ECENHK_06660 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AFP69215 UniProt:  A0A181CX85 LinkDB All DBs Position 1447160..1447273 Genome browser AA seq 37 aa AA seqDB search MWYFAWILGTLLACAFGVITALALEHVEATKAGEEKH NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcatggattttagggacgcttcttgcctgtgcttttggtgtcatcacc gccctggcgcttgagcatgttgaagcgacgaaagcgggtgaagaaaaacactga

DBGET integrated database retrieval system