Ensifer sp. PDNC004: JVX98_16250 Help Entry JVX98_16250       CDS       T09472                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism enp  Ensifer sp. PDNC004 Pathway enp01100   Metabolic pathways enp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:enp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JVX98_16250    00074 Mycolic acid biosynthesis     JVX98_16250   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JVX98_16250 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Delta_lysin Motif Other DBs NCBI-ProteinID:  QRY69729 LinkDB All DBs Position complement(1647117..1647353) Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIDHLGVDAEKVSEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgtaaagaaaattgttattgatcatcttggcgtcgacgcc gaaaaggtcagcgaaggcgcaagcttcatcgacgacctcggcgcagactcgctcgacacc gtcgaactggtcatggctttcgaagaagaattcggcgttgaaatcccggacgacgctgct gactcgatcctgactgtcggcgacgccgtcaagttcatcgaaaaggcccaggcctaa

DBGET integrated database retrieval system