Enterobacter sp. R4-368: H650_07035 Help Entry H650_07035        CDS       T02700                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism enr  Enterobacter sp. R4-368 Pathway enr01100   Metabolic pathways enr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:enr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H650_07035    00074 Mycolic acid biosynthesis     H650_07035   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H650_07035 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  AGN84943 LinkDB All DBs Position complement(1330570..1330812) Genome browser AA seq 80 aa AA seqDB search MNMYTELYNAIASTIADAKDLPLEEINEQTTISELGLDSLDYVELMVMVKKQFNITINFE AAMKSNDITLKEFCTSVLSA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgaatatgtacacagaactttataacgctattgcaagcactattgccgatgcaaaagat cttcctttagaagagataaacgagcaaacgactatttcagaattaggtttagatagcctg gactatgtagaactgatggtaatggttaaaaagcaatttaatataactataaatttcgaa gcagcaatgaaatcaaatgacattactcttaaagagttttgtacatccgttttatcagct tag

DBGET integrated database retrieval system